BLASTP 2.2.11 [Jun-05-2005]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PSPTO_0862|Pseudomonas syringae pv. tomato str.
DC3000|hypothetical protein
         (307 letters)

Database: genes 
           5,338,631 sequences; 1,916,570,134 total letters

Searching..................................................done


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pst:PSPTO_0862  hypothetical protein                              594   e-168
psb:Psyr_1445  hypothetical protein                               551   e-155
avn:Avin_36250  hypothetical protein                              359   1e-97
pau:PA14_59910  hypothetical protein                              346   1e-93
pap:PSPA7_4512  hypothetical protein                              343   6e-93
pfl:PFL_4704  hypothetical protein                                310   1e-82
ajs:Ajs_2189  hypothetical protein                                303   7e-81
har:HEAR2017  putative signal peptide                             303   9e-81
bpt:Bpet1491  putative secreted protein                           302   2e-80
bxe:Bxe_A1187  hypothetical protein                               302   2e-80
pla:Plav_3421  putative secreted protein                          301   3e-80
xca:xccb100_2449  putative secreted protein                       301   4e-80
xcv:XCV2370  putative secreted protein                            300   6e-80
mpt:Mpe_A2391  hypothetical protein                               300   8e-80
tmz:Tmz1t_0951  hypothetical protein                              299   1e-79
dia:Dtpsy_1167  putative secreted protein                         298   2e-79
aav:Aave_0505  hypothetical protein                               298   3e-79
rpf:Rpic12D_0680  hypothetical protein                            298   3e-79
bpt:Bpet1359  hypothetical protein                                297   5e-79
bpt:Bpet1078  hypothetical protein                                296   8e-79
tau:Tola_2441  putative secreted protein                          296   1e-78
xcb:XC_2034  hypothetical protein                                 296   1e-78
net:Neut_0089  putative secreted protein                          295   2e-78
eba:ebA2409  hypothetical protein                                 294   4e-78
ajs:Ajs_1401  putative secreted protein                           294   4e-78
ajs:Ajs_1259  putative secreted protein                           294   4e-78
rme:Rmet_2350  putative secreted protein                          294   4e-78
dac:Daci_4176  putative signal peptide                            294   5e-78
bpt:Bpet4268  putative secreted protein                           294   5e-78
tgr:Tgr7_2856  hypothetical protein                               291   4e-77
pwa:Pecwa_1629  putative secreted protein                         288   3e-76
xac:XAC2272  hypothetical protein                                 287   5e-76
dze:Dd1591_0438  putative signal peptide                          279   2e-73
pfs:PFLU1930  hypothetical protein                                268   2e-70
pfo:Pfl01_3020  hypothetical protein                              262   2e-68
spe:Spro_4089  hypothetical protein                               243   1e-62
pwa:Pecwa_0657  hypothetical protein                              239   2e-61
pmr:PMI2580  hypothetical protein                                 238   3e-61
spq:SPAB_05383  hypothetical protein                              238   4e-61
epy:EpC_31960  conserved uncharacterized protein                  238   5e-61
epy:EpC_30340  conserved uncharacterized protein                  238   5e-61
sei:SPC_4425  hypothetical protein                                237   6e-61
stt:t4266  hypothetical protein                                   237   6e-61
sty:STY4569  hypothetical protein                                 237   6e-61
spe:Spro_0334  hypothetical protein                               236   2e-60
yen:YE3485  hypothetical protein                                  235   2e-60
elf:LF82_p685  hypothetical protein                               235   3e-60
ypz:YPZ3_0316  hypothetical protein                               234   7e-60
spe:Spro_4172  hypothetical protein                               233   2e-59
ypi:YpsIP31758_3708  hypothetical protein                         233   2e-59
plu:plu1082  hypothetical protein                                 231   3e-59
ses:SARI_03120  hypothetical protein                              231   4e-59
ppw:PputW619_3327  hypothetical protein                           231   6e-59
ppf:Pput_2945  hypothetical protein                               230   1e-58
xbo:XBJ1_1528  hypothetical protein                               229   1e-58
cro:ROD_33501  hypothetical protein                               228   4e-58
hit:NTHI0131  hypothetical protein                                224   4e-57
eic:NT01EI_0344  hypothetical protein                             224   4e-57
eca:ECA0569  hypothetical protein                                 224   7e-57
hso:HS_1761  hypothetical protein                                 222   3e-56
hdu:HD0936  hypothetical protein                                  221   3e-56
xbo:XBJ1_3396  conserved hypothetical protein; putative expo...   221   5e-56
hsm:HSM_1701  hypothetical protein                                219   2e-55
ecq:ECED1_3565  conserved hypothetical protein; putative exp...   213   2e-53
kpu:KP1_0617  hypothetical protein                                200   8e-50
noc:Noc_0645  hypothetical protein                                148   5e-34
aav:Aave_2758  hypothetical protein                               100   2e-19
lpp:lpp2389  hypothetical protein                                 100   2e-19
lpc:LPC_1871  hypothetical protein                                 99   3e-19
maq:Maqu_3929  hypothetical protein                                97   1e-18
lpc:LPC_2287  hypothetical protein                                 94   1e-17
lpp:lpp1063  hypothetical protein                                  92   3e-17
lpn:lpg0992  hypothetical protein                                  92   3e-17
eba:ebA410  hypothetical protein                                   90   2e-16
lpf:lpl1025  hypothetical protein                                  90   2e-16
>pst:PSPTO_0862 hypothetical protein
          Length = 307

 Score =  594 bits (1531), Expect = e-168
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60
           MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR
Sbjct: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60

Query: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120
           SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI
Sbjct: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120

Query: 121 VEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQM 180
           VEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQM
Sbjct: 121 VEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQM 180

Query: 181 LYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ 240
           LYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ
Sbjct: 181 LYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ 240

Query: 241 RITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRAT 300
           RITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRAT
Sbjct: 241 RITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRAT 300

Query: 301 RGAKHEE 307
           RGAKHEE
Sbjct: 301 RGAKHEE 307
>psb:Psyr_1445 hypothetical protein
          Length = 307

 Score =  551 bits (1420), Expect = e-155
 Identities = 284/306 (92%), Positives = 292/306 (95%)

Query: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60
           M +LRVLT S LLMVL G  Q+ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR
Sbjct: 1   MSVLRVLTCSTLLMVLAGNAQVASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60

Query: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120
           SLT+KLRVQSTGGAIYLFAK+AIEPTRLQLQNAKTGEIILVDIAATEA  DQPALEPVKI
Sbjct: 61  SLTEKLRVQSTGGAIYLFAKEAIEPTRLQLQNAKTGEIILVDIAATEAQTDQPALEPVKI 120

Query: 121 VEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQM 180
           VEGETSSARYGGAATARSAKATTKS DSTSRSNDE+DEPEEVVKRETPVPVVLTRYAAQM
Sbjct: 121 VEGETSSARYGGAATARSAKATTKSTDSTSRSNDEEDEPEEVVKRETPVPVVLTRYAAQM 180

Query: 181 LYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ 240
           LYAPLRTVEPVDGIAQVKVERSLDL TLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ
Sbjct: 181 LYAPLRTVEPVDGIAQVKVERSLDLTTLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ 240

Query: 241 RITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRAT 300
           RITLDPRELMGEFVTAAFQHPYLGS+G+ASDTTTLYLVTRGHGLTQA VFSA  ADPRA 
Sbjct: 241 RITLDPRELMGEFVTAAFQHPYLGSRGDASDTTTLYLVTRGHGLTQAAVFSATQADPRAA 300

Query: 301 RGAKHE 306
           +GAKHE
Sbjct: 301 QGAKHE 306
>avn:Avin_36250 hypothetical protein
          Length = 307

 Score =  359 bits (922), Expect = 1e-97
 Identities = 192/303 (63%), Positives = 226/303 (74%), Gaps = 7/303 (2%)

Query: 9   GSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRV 68
           G ALL +   T Q   AVEI RWERLPLA+PL + QERIVFVDQNVRVG+P  L  KLRV
Sbjct: 8   GGALLTLFALTAQ---AVEIQRWERLPLAVPLLVGQERIVFVDQNVRVGMPPDLVGKLRV 64

Query: 69  QSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSA 128
           QSTGGA+YL A++AI PTRLQLQN   GEI+LVDIAAT A  DQP LEPVKIV G+ + +
Sbjct: 65  QSTGGALYLLAQEAILPTRLQLQNVANGEIMLVDIAATPAQADQPGLEPVKIVAGDNTPS 124

Query: 129 RYGGAATARS---AKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPL 185
           RYG    ARS   A   T + D++   +D++ E     KRETP+PVVLTRYAAQMLYAPL
Sbjct: 125 RYGQQTVARSRSTASRNTAAQDTSPEQDDQEQEAPATPKRETPIPVVLTRYAAQMLYAPL 184

Query: 186 RTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLD 245
           RTVEPV+GIAQ +VER LDL+TLLP LPV++T LGAWRLD F VTAVKL+N  AQ ++LD
Sbjct: 185 RTVEPVEGIAQARVERRLDLSTLLPVLPVEATVLGAWRLDGFRVTAVKLRNAGAQPVSLD 244

Query: 246 PRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSA-APADPRATRGAK 304
           PRELMG+FV A FQHPYL  +GNA+DTTTLYLVTRG  L ++ + +A    DPR  R   
Sbjct: 245 PRELMGDFVAATFQHPYLDGRGNATDTTTLYLVTRGKSLAESLLPAAVGQIDPRGGRHGD 304

Query: 305 HEE 307
            E+
Sbjct: 305 AEQ 307
>pau:PA14_59910 hypothetical protein
          Length = 294

 Score =  346 bits (887), Expect = 1e-93
 Identities = 183/300 (61%), Positives = 223/300 (74%), Gaps = 12/300 (4%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           ++R  TGS LLM+ + T  +A AVEILRWER+PLAIPL + QERIVFVD+NVRVG+PR L
Sbjct: 1   MIRKSTGSLLLMLALPT--LAHAVEILRWERIPLAIPLTVGQERIVFVDRNVRVGVPRDL 58

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVE 122
             KLRVQSTGGA+YL A + I P RL+LQ+A  GE +L+DIAATEA  DQ   EPV+IV 
Sbjct: 59  QGKLRVQSTGGALYLLANEPIPPARLRLQDATNGEQMLIDIAATEATADQQPREPVRIVA 118

Query: 123 GETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           GE     YG +  A+ + A  ++         E  E  + V RETPVPVVLTRYAAQMLY
Sbjct: 119 GEPVDPHYGQSREAQPSAAAKQT---------EHAEAPKAVPRETPVPVVLTRYAAQMLY 169

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVEPVDG+ QV+V+R LDL TLLP+LP+ +T LGAWRLDD+++TAVKLQN +AQ +
Sbjct: 170 APLRTVEPVDGVGQVRVKRQLDLTTLLPSLPITATALGAWRLDDYYITAVKLQNASAQHL 229

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATV-FSAAPADPRATR 301
            LDPR+LMG FV A FQHPYLG +G+ASDTTT+YLVTRG GL  A +  S +  DP+  R
Sbjct: 230 ALDPRDLMGNFVAATFQHPYLGPRGDASDTTTVYLVTRGRGLADALLPSSISQIDPKGGR 289
>pap:PSPA7_4512 hypothetical protein
          Length = 294

 Score =  343 bits (881), Expect = 6e-93
 Identities = 182/300 (60%), Positives = 224/300 (74%), Gaps = 12/300 (4%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           ++R  TGS LLM+ + T  +A AVEILRWER+PLAIPL + QERIVFVD+NVRVG+PR L
Sbjct: 1   MIRKSTGSLLLMLALPT--LAHAVEILRWERIPLAIPLTVGQERIVFVDRNVRVGVPRDL 58

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVE 122
             KLRVQSTGGA+YL A + I P RL+LQ+A  GE +L+DIAA+EA  DQ   EPV+IV 
Sbjct: 59  QGKLRVQSTGGALYLLANEPIPPARLRLQDATNGEQMLIDIAASEAAADQQPREPVRIVA 118

Query: 123 GETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           GE  +  YG    A+ + A  ++  +         E  + V RETPVPVVLTRYAAQMLY
Sbjct: 119 GEPVAPHYGQPREAQPSAAAKQTAQA---------EAPKAVPRETPVPVVLTRYAAQMLY 169

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVEPVDG+ QV+V+R LDL TLLP+LP+ +T LGAWRLDD++VTAVKLQN +AQ +
Sbjct: 170 APLRTVEPVDGVGQVRVKRQLDLNTLLPSLPITATALGAWRLDDYYVTAVKLQNASAQHL 229

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSA-APADPRATR 301
            LDPR+LMG F+ A FQHPYLG +G+ASDTTT+YLVTRG GL  A + SA +  DP+  R
Sbjct: 230 ALDPRDLMGNFIAATFQHPYLGPRGDASDTTTVYLVTRGRGLADALLPSAISQIDPKGGR 289
>pfl:PFL_4704 hypothetical protein
          Length = 303

 Score =  310 bits (793), Expect = 1e-82
 Identities = 163/302 (53%), Positives = 215/302 (71%), Gaps = 10/302 (3%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L G+ALL+     T  A AVEI++WER+PLA+PL + +ERIVFVDQNVRVG+P ++   L
Sbjct: 11  LAGTALLV-----TTSAEAVEIMQWERIPLAVPLHVGEERIVFVDQNVRVGIPPNIAGSL 65

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS GGAIY  A + I PTRLQLQN  TGEI+LVDIAAT     Q +LEP KIV G++ 
Sbjct: 66  RVQSVGGAIYFRASEEIPPTRLQLQNVATGEIMLVDIAATAPKPGQASLEPAKIVTGDSI 125

Query: 127 SARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLR 186
           + R  G    ++AK +T     +      ++E EE  + ETP  V LTRYAAQMLYAPLR
Sbjct: 126 AGRRYG----QTAKTSTPGSARSQTPPPAEEEAEEEPRHETPSTVALTRYAAQMLYAPLR 181

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
           T+EPV GI  V+V+R +DL+TLLPTLPV++  +GAW+LD+ +VTA+KL+N + Q++TL+P
Sbjct: 182 TIEPVAGIQPVRVDRKIDLSTLLPTLPVEAVAIGAWQLDNTFVTAIKLRNMSPQQLTLNP 241

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAA-PADPRATRGAKH 305
           R+L+G F TA +QHPYLG +GN SDTTTLYLVT+G GL  + + S+    DP+     +H
Sbjct: 242 RDLLGSFATATYQHPYLGPRGNPSDTTTLYLVTQGKGLKHSLLPSSVNQIDPKMGGEREH 301

Query: 306 EE 307
            +
Sbjct: 302 SK 303
>ajs:Ajs_2189 hypothetical protein
          Length = 304

 Score =  303 bits (777), Expect = 7e-81
 Identities = 162/292 (55%), Positives = 205/292 (70%), Gaps = 16/292 (5%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+  A +++++G    + AVEILRWERLPL +PL + QER+VF+D+NVRVG+P S+ D L
Sbjct: 6   LSALAGVLLILGFVPASQAVEILRWERLPLPVPLVVGQERVVFIDRNVRVGVPASVGDHL 65

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS GGAIYL A + I PTRLQLQ+ ++G +IL+DIAA  A   Q  LEPV+IV+ E  
Sbjct: 66  RVQSAGGAIYLRASEPIPPTRLQLQDVESGALILLDIAAEPAKDGQAPLEPVRIVDAEAP 125

Query: 127 SARYGGAATARSAKATTKSMDSTSRSNDEDDEP--EEVVKRETPVPVVLTRYAAQMLYAP 184
           + RYGG A               S ++++ D P  + V +RETPVPVVLTR+AAQ LYAP
Sbjct: 126 AKRYGGGAA--------------SGADEQADAPAGKSVPRRETPVPVVLTRHAAQNLYAP 171

Query: 185 LRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITL 244
           LRTVEPV GI +V + R L L TLLPTLPV +  L AWRL+D WVTAV+L N +A+ + L
Sbjct: 172 LRTVEPVAGIGRVNLRRGLALDTLLPTLPVHARALAAWRLEDQWVTAVRLTNTSARWLDL 231

Query: 245 DPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD 296
           DPR L G FV A FQHP LG  G ASDTT LYLVTRGHGL ++ + + +P D
Sbjct: 232 DPRALQGNFVAATFQHPNLGPAGTASDTTVLYLVTRGHGLAESLLPALSPID 283
>har:HEAR2017 putative signal peptide
          Length = 305

 Score =  303 bits (776), Expect = 9e-81
 Identities = 157/294 (53%), Positives = 207/294 (70%), Gaps = 10/294 (3%)

Query: 4   LRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLT 63
           ++ L  + L ++ V +   A AVEILRWER+PLA+PLR+ QER+VF+++NVRVG+P  + 
Sbjct: 1   MKHLVLALLGLLAVASAPFAQAVEILRWERMPLAVPLRVGQERVVFINRNVRVGVPAGVG 60

Query: 64  DKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEG 123
           ++LRVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA  A   +  LEPV+IVEG
Sbjct: 61  ERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPAKDGEAELEPVRIVEG 120

Query: 124 ETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYA 183
           +++  RYG  A            D+ +R+ D+        +RETPVPVVLTR+AAQ LYA
Sbjct: 121 DSAPTRYGDQADGAD--------DAPARAQDQAGA--RAARRETPVPVVLTRFAAQNLYA 170

Query: 184 PLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRIT 243
           PLRTVEP+ G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N +   IT
Sbjct: 171 PLRTVEPLPGVMRVNLRRDLDLGTLVPTLPVRAVALASWRLEDQWVTAVRLTNSSGGWIT 230

Query: 244 LDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           LDPR L G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP
Sbjct: 231 LDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAINRFDP 284
>bpt:Bpet1491 putative secreted protein
          Length = 310

 Score =  302 bits (773), Expect = 2e-80
 Identities = 163/297 (54%), Positives = 205/297 (69%), Gaps = 18/297 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L G   +   V  +  A AVEILRWER+PLA+PL++ QER+VF+D+NVRVG+P  ++++L
Sbjct: 8   LPGLLAVAAAVVMSSAAQAVEILRWERMPLAVPLKVGQERVVFIDKNVRVGVPAGVSERL 67

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGET 125
           RVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG +
Sbjct: 68  RVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGNS 126

Query: 126 SSARYG---GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           + ARYG   G A    A+A             +D       +RETPVPVVLTRYAAQ LY
Sbjct: 127 TPARYGDQPGDADDAPARA-------------QDPTGTRATRRETPVPVVLTRYAAQNLY 173

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVEP+ G+ +V + R  DL TL+PTLPV++  L +WRL+D WVTAV+L N +   I
Sbjct: 174 APLRTVEPLPGVMRVNLRRDFDLGTLMPTLPVRAVALASWRLEDQWVTAVRLTNSSGGWI 233

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRA 299
           TLDPR L G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP A
Sbjct: 234 TLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAINRFDPAA 290
>bxe:Bxe_A1187 hypothetical protein
          Length = 310

 Score =  302 bits (773), Expect = 2e-80
 Identities = 163/297 (54%), Positives = 205/297 (69%), Gaps = 18/297 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L G   +   V  +  A AVEILRWER+PLA+PL++ QER+VF+D+NVRVG+P  ++++L
Sbjct: 8   LPGLLAVAAAVVMSSAAQAVEILRWERMPLAVPLKVGQERVVFIDKNVRVGVPAGVSERL 67

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGET 125
           RVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG +
Sbjct: 68  RVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGNS 126

Query: 126 SSARYG---GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           + ARYG   G A    A+A             +D       +RETPVPVVLTRYAAQ LY
Sbjct: 127 TPARYGDQPGDADDAPARA-------------QDPTGTRATRRETPVPVVLTRYAAQNLY 173

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVEP+ G+ +V + R  DL TL+PTLPV++  L +WRL+D WVTAV+L N +   I
Sbjct: 174 APLRTVEPLPGVMRVNLRRDFDLGTLMPTLPVRAVALASWRLEDQWVTAVRLTNSSGGWI 233

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRA 299
           TLDPR L G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP A
Sbjct: 234 TLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAINRFDPAA 290
>pla:Plav_3421 putative secreted protein
          Length = 308

 Score =  301 bits (771), Expect = 3e-80
 Identities = 162/285 (56%), Positives = 206/285 (72%), Gaps = 12/285 (4%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V     A AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P ++ ++LRVQS GG
Sbjct: 15  LLAVALASAAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAAVGERLRVQSAGG 74

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGETSSARYGG 132
           A+YL A + IEP RLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG T+SARYGG
Sbjct: 75  AVYLRASEPIEPARLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGNTASARYGG 133

Query: 133 AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVD 192
              A + K + +S DST              +RETPV VVLTR+AAQ LYAPLRTVEP+ 
Sbjct: 134 QP-AGADKVSARSGDSTGAPP---------ARRETPVAVVLTRFAAQNLYAPLRTVEPLA 183

Query: 193 GIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGE 252
           G+ +V + R+LDL TL+PTL V++  L +WRL+D WVTAV+L N +A  ITLDPR L G+
Sbjct: 184 GVMRVNLRRNLDLGTLMPTLSVRAVALASWRLEDQWVTAVRLTNSSAAWITLDPRVLQGD 243

Query: 253 FVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           F+TA FQH  LG +G   DTTT+YLVTRG GL Q+ + +    DP
Sbjct: 244 FLTATFQHEALGPRGTPEDTTTVYLVTRGRGLAQSLLPAIHRFDP 288
>xca:xccb100_2449 putative secreted protein
          Length = 308

 Score =  301 bits (770), Expect = 4e-80
 Identities = 152/284 (53%), Positives = 201/284 (70%), Gaps = 10/284 (3%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V +  +A A+E++RWER+PLA+ L++ QERIVF+D+NVRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVASAPVAQALEVMRWERMPLAVALKVGQERIVFIDRNVRVGMPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGA 133
           A+YL A + IEPTRLQLQ+  TG +IL+DIAA  A   +PALEPV+IVEG+  SARYG  
Sbjct: 71  AVYLRANEPIEPTRLQLQDTDTGALILLDIAAEPAKGGEPALEPVRIVEGDVPSARYGDQ 130

Query: 134 ATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDG 193
                      +  +T++S           +RETP+ VVLTR+AAQ LYAPLRTVEP+ G
Sbjct: 131 PADADEVPAPANRQATAQS----------ARRETPISVVLTRFAAQNLYAPLRTVEPLPG 180

Query: 194 IAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEF 253
           + +V + R LDL TL+PTLPV++T L +WRL+D WVTAV+L N  A  ITLDPR L G+F
Sbjct: 181 VMRVNLRRDLDLGTLIPTLPVRATALASWRLEDQWVTAVRLTNTDAGWITLDPRVLQGDF 240

Query: 254 VTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +TA FQH  LG +G   DTT LYLVTRG G+TQ+ + +    DP
Sbjct: 241 LTATFQHEALGPRGTPEDTTVLYLVTRGRGITQSLLPALHRFDP 284
>xcv:XCV2370 putative secreted protein
          Length = 304

 Score =  300 bits (769), Expect = 6e-80
 Identities = 167/298 (56%), Positives = 209/298 (70%), Gaps = 21/298 (7%)

Query: 6   VLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDK 65
           VLT   LL V V   Q   AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P  + ++
Sbjct: 5   VLTLLGLLAVAVAPAQ---AVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGER 61

Query: 66  LRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGE 124
           LRVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG 
Sbjct: 62  LRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGS 120

Query: 125 TSSARYG---GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQML 181
           ++ ARYG   G A    A+A  +S+   +R             RETPVPVVLTR+AAQ L
Sbjct: 121 STPARYGDQAGGADEDPARAQDQSVARAAR-------------RETPVPVVLTRFAAQNL 167

Query: 182 YAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQR 241
           YAPLRTVEP+ G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N ++  
Sbjct: 168 YAPLRTVEPLAGVMRVNLRRGLDLGTLMPTLPVRAVALASWRLEDQWVTAVRLTNSSSGW 227

Query: 242 ITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRA 299
           +TLDPR L G+F+TA FQH  LG +G   DTT LYLVTRG GL Q+ + +    DP A
Sbjct: 228 VTLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRFDPAA 285
>mpt:Mpe_A2391 hypothetical protein
          Length = 304

 Score =  300 bits (768), Expect = 8e-80
 Identities = 161/292 (55%), Positives = 202/292 (69%), Gaps = 16/292 (5%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+  A +++ +G    + AVEILRWERLPL +PL + QER+VF+D+NVRVG+P S+ D L
Sbjct: 6   LSALAGVLLTLGFVPASQAVEILRWERLPLPVPLVVGQERVVFIDRNVRVGVPASVGDHL 65

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS GGAIYL A + I PTRLQLQ+ ++G +IL+DIAA  A   Q  LEPV+IVE E  
Sbjct: 66  RVQSAGGAIYLRASEPIPPTRLQLQDVESGALILLDIAAEPAKDGQAPLEPVRIVEAEAP 125

Query: 127 SARYGGAATARSAKATTKSMDSTSRSNDEDDEPEE--VVKRETPVPVVLTRYAAQMLYAP 184
           + RYGG A               S ++++ D P +  + +RETPVPVVLTR+AAQ LYAP
Sbjct: 126 AKRYGGGAA--------------SGADEQADAPADKPLPRRETPVPVVLTRHAAQNLYAP 171

Query: 185 LRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITL 244
           LRTVEPV GI +V + R L L TLLPTLPV +  L AWRL+D WVTAV+L N  A+ + L
Sbjct: 172 LRTVEPVAGIGRVNLRRGLALDTLLPTLPVHARALAAWRLEDQWVTAVRLTNTAARWLDL 231

Query: 245 DPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD 296
           DPR L G FV A FQHP LG  G  SDTT LYLVTRGHGL ++ + + +P D
Sbjct: 232 DPRALQGNFVAATFQHPNLGPAGTPSDTTVLYLVTRGHGLAESLLPALSPID 283
>tmz:Tmz1t_0951 hypothetical protein
          Length = 304

 Score =  299 bits (766), Expect = 1e-79
 Identities = 163/311 (52%), Positives = 207/311 (66%), Gaps = 22/311 (7%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+  A +++++G    + AVEILRWERLPL +PL + QER+VF+D+NVRVG+P S+ D L
Sbjct: 6   LSALAGVLLILGFVPASQAVEILRWERLPLPVPLVVGQERVVFIDRNVRVGVPASVGDHL 65

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS GGAIYL A + I PTRLQLQ+ ++G +IL+DIAA  A   Q  LEPV+IVE E  
Sbjct: 66  RVQSAGGAIYLRASEPIPPTRLQLQDVESGTLILLDIAAEPAKDGQAPLEPVRIVEAEAP 125

Query: 127 SARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLR 186
           + RYGG A + + +      D +            + +RETPVPVVLTR+AAQ LYAPLR
Sbjct: 126 AKRYGGGAASGADEQAIAPADKS------------LPRRETPVPVVLTRHAAQNLYAPLR 173

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
           TVEPV GI +V + R L L TLLPTLPV +  L AWRL+D WVTAV+L N  A+ + L+P
Sbjct: 174 TVEPVAGIGRVNLRRGLALDTLLPTLPVHARALAAWRLEDQWVTAVRLTNTAARWLDLEP 233

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPR-------- 298
           R L G FV A FQHP LG  G  SDTT LYLVTRGHGL ++ + + +P D          
Sbjct: 234 RALQGNFVAATFQHPNLGPAGTPSDTTVLYLVTRGHGLAESLLPALSPIDATVNLPPAAA 293

Query: 299 --ATRGAKHEE 307
             +T GA+ EE
Sbjct: 294 AGSTGGARDEE 304
>dia:Dtpsy_1167 putative secreted protein
          Length = 305

 Score =  298 bits (764), Expect = 2e-79
 Identities = 158/288 (54%), Positives = 203/288 (70%), Gaps = 18/288 (6%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V    ++ AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVAAAPVSHAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGETSSARYG- 131
           A+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG ++ ARYG 
Sbjct: 71  AVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGSSTPARYGD 129

Query: 132 --GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVE 189
             G A    A+A             +D       +RETPVPVVLTR+AAQ LYAPLRTVE
Sbjct: 130 QPGGADEAPARA-------------QDQAGTRATRRETPVPVVLTRFAAQNLYAPLRTVE 176

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
            + G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N ++  +TLDPR L
Sbjct: 177 SLPGVMRVNLRRDLDLGTLMPTLPVRAVALASWRLEDQWVTAVRLTNSSSGWVTLDPRVL 236

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
            G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP
Sbjct: 237 QGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDP 284
>aav:Aave_0505 hypothetical protein
          Length = 331

 Score =  298 bits (763), Expect = 3e-79
 Identities = 165/329 (50%), Positives = 209/329 (63%), Gaps = 31/329 (9%)

Query: 4   LRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLT 63
           LR L   A L +  G    A A++ILRWER+P+A+PLR+ +ER+VF+D+NVRVG+P ++ 
Sbjct: 9   LRALALGATLWL--GGAPAAHALQILRWERMPMAVPLRVGEERVVFIDRNVRVGVPAAIA 66

Query: 64  DKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEG 123
           D+LRVQS GGAIYL A +AIEPTRLQLQ+A +G +IL+DIAA      Q  LEPV+I+EG
Sbjct: 67  DRLRVQSAGGAIYLRASEAIEPTRLQLQDADSGALILIDIAAEAPKEGQGPLEPVRIIEG 126

Query: 124 ETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEV---VKRETPVPVVLTRYAAQM 180
           +T   RYG    AR A A T +      +      P E     + ETPV VVLTRYAAQ 
Sbjct: 127 DTPGPRYG----ARDASADTDAGSGEQSAETHASGPTEPGARARHETPVAVVLTRYAAQS 182

Query: 181 LYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ 240
           LYAPLRTVEP  G++Q  + R L+L  L P+LPV++  L AWR++D WVTAV+L N + +
Sbjct: 183 LYAPLRTVEPARGVSQANLRRGLNLDALAPSLPVRAQALAAWRMEDQWVTAVRLTNTSPR 242

Query: 241 RITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGL---------------- 284
            + LDPR L+G+FV A FQHP LG  G+A+DTT LYLVTRG GL                
Sbjct: 243 WVDLDPRLLIGDFVAATFQHPGLGPAGDATDTTVLYLVTRGRGLGDALLPRISRIDAAQN 302

Query: 285 ------TQATVFSAAPADPRATRGAKHEE 307
                   A V  A PA PR   GA HE+
Sbjct: 303 LPPPAADAAAVTEATPATPRQPSGADHEK 331
>rpf:Rpic12D_0680 hypothetical protein
          Length = 305

 Score =  298 bits (763), Expect = 3e-79
 Identities = 153/290 (52%), Positives = 201/290 (69%), Gaps = 12/290 (4%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L   A ++  +G      AVEILRWERLPLA+PL + QER+VF+++NVR+G+P  + ++L
Sbjct: 6   LPALAGVLFCLGFVPAGHAVEILRWERLPLAVPLVVGQERVVFIERNVRIGVPAGVGEQL 65

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQSTGGAIYL A   + PTRLQLQ+ ++G +IL+DIAA  A   QPALEPV+IV+G+  
Sbjct: 66  RVQSTGGAIYLRASAPVPPTRLQLQDVESGALILLDIAAEPAKAGQPALEPVRIVDGDVP 125

Query: 127 SARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLR 186
           + RYG  A+             ++ ++D+   P    +R TPV VVLTRYAAQ LYAPLR
Sbjct: 126 ATRYGEPASP------------SATADDDAQRPTPAARRATPVAVVLTRYAAQNLYAPLR 173

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
           TVEP+ GI +V + R+L L TLLPTLPV++  L  WRL+D WVTAVKL N + + + LDP
Sbjct: 174 TVEPMAGIGRVNLRRNLALDTLLPTLPVRAQALAVWRLEDQWVTAVKLTNTSGRWLDLDP 233

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD 296
           R L G+F+ A FQHP LG  G A+DTT +YLVTRGHGL ++ +   AP D
Sbjct: 234 RALQGDFLAATFQHPTLGPAGRAADTTVVYLVTRGHGLAESLLPKVAPID 283
>bpt:Bpet1359 hypothetical protein
          Length = 302

 Score =  297 bits (761), Expect = 5e-79
 Identities = 160/307 (52%), Positives = 205/307 (66%), Gaps = 28/307 (9%)

Query: 13  LMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTG 72
           L+V         A+EILRWERLPLA+ L ++QER+VF+D+NVRVG+P SL  +LRVQS G
Sbjct: 10  LLVTTSLPTTVQALEILRWERLPLAVSLHVDQERVVFIDRNVRVGVPASLAGRLRVQSAG 69

Query: 73  GAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGG 132
           GAIYL A + IEPTRLQLQ+A +G +IL+DIAA  AP  Q  LEPV+IVE E +  RYG 
Sbjct: 70  GAIYLRASEPIEPTRLQLQDADSGALILLDIAAEPAPAGQAPLEPVRIVEAEGAPTRYGD 129

Query: 133 AATARSAKATTKSMDSTSRSNDEDDEPEEVVKR---ETPVPVVLTRYAAQMLYAPLRTVE 189
            A A               +  +D+  +E V R   ETPVPVVLTRYAAQ LYAPLRTVE
Sbjct: 130 LAAA---------------AKSDDNGTQEAVSRTARETPVPVVLTRYAAQNLYAPLRTVE 174

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
           PV GI +V ++R+L L TLLPTLPV++  L AWRLD  WVTAV+L N + + ++LDPR+L
Sbjct: 175 PVSGITRVNLKRNLPLDTLLPTLPVRARALAAWRLDGLWVTAVRLSNISKRWLSLDPRDL 234

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD----------PRA 299
            G+F+T AFQH  LG  G   DT+ +YLVT+GHGL ++ + + +P +          P  
Sbjct: 235 QGDFMTGAFQHNTLGPAGTPDDTSVVYLVTKGHGLGESLLPTISPVNAALNLPEPKTPAR 294

Query: 300 TRGAKHE 306
             G +HE
Sbjct: 295 KDGGRHE 301
>bpt:Bpet1078 hypothetical protein
          Length = 305

 Score =  296 bits (759), Expect = 8e-79
 Identities = 153/284 (53%), Positives = 197/284 (69%), Gaps = 10/284 (3%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V    +A AVEILRWER+PLA+PLR+ QERIVF+D+NVRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVAAAPVAHAVEILRWERMPLAVPLRVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGA 133
           A+YL A + IEPTRLQLQ+A TG +IL+DIAA  A   +PALEPV+IVEG+ + ARYG  
Sbjct: 71  AVYLRASEPIEPTRLQLQDADTGALILLDIAAEPAKDGEPALEPVRIVEGDATPARYGEQ 130

Query: 134 ATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDG 193
                   T  +  +  R +          +RE P+PVVLTR+AAQ LYAPLRTVE + G
Sbjct: 131 RADGDEAVTPTNGQANVRGS----------RREIPIPVVLTRFAAQNLYAPLRTVESLPG 180

Query: 194 IAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEF 253
           + +V +   LDL TL+PTLPV +T L +WRL+D WVTAV+L N +A  +TLDPR L G+F
Sbjct: 181 VMRVNLRSGLDLRTLMPTLPVSATALASWRLEDQWVTAVRLTNTSAGWVTLDPRVLQGDF 240

Query: 254 VTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           + A FQH  LG +G   DTT LYLVTRG GL Q+ + +    DP
Sbjct: 241 LAATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRFDP 284
>tau:Tola_2441 putative secreted protein
          Length = 300

 Score =  296 bits (758), Expect = 1e-78
 Identities = 161/286 (56%), Positives = 199/286 (69%), Gaps = 14/286 (4%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           M+      +A AVEILRWERLPLA+PL++ +ERIVFVD+NVRVG+P S+ D+LRVQS GG
Sbjct: 11  MLACALVPMAHAVEILRWERLPLAVPLQVGEERIVFVDRNVRVGVPASVGDRLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGA 133
           A+YL A + IEPTRLQLQ+A +G +IL+DIAA  A   +P LEPV+IVEG  +  RYG A
Sbjct: 71  AVYLRASEPIEPTRLQLQDADSGALILLDIAAEPAKDGEPPLEPVRIVEGNATPQRYGQA 130

Query: 134 ATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDG 193
             + +A          + S D+   P    +RETPV VVLTRYAAQ LYAPLRTVEPV G
Sbjct: 131 QESGTA----------APSPDQARPP----RRETPVAVVLTRYAAQNLYAPLRTVEPVPG 176

Query: 194 IAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEF 253
           + +V + R L L TLLPTLPV++  L AWRL+D WVTAV+L +     I LDPR L G+F
Sbjct: 177 VMRVNLRRDLPLDTLLPTLPVRAEALAAWRLEDQWVTAVRLTHTGGGWIDLDPRALQGDF 236

Query: 254 VTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRA 299
           +TA FQHP LG +G   DTT LYLVTRG GL Q+ + +    DP A
Sbjct: 237 LTATFQHPTLGPRGTPEDTTVLYLVTRGRGLPQSLLPAIHRFDPAA 282
>xcb:XC_2034 hypothetical protein
          Length = 308

 Score =  296 bits (757), Expect = 1e-78
 Identities = 150/284 (52%), Positives = 200/284 (70%), Gaps = 10/284 (3%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V +  +A A+E++RWER+PLA+ L++ QERIVF+D+NVRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVASAPVAQALEVMRWERMPLAVALKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGA 133
           A+YL A + IEPTRLQLQ+  TG +IL+DIAA  A   +PALEPV+IVEG+  SAR G  
Sbjct: 71  AVYLRANEPIEPTRLQLQDTDTGALILLDIAAEPAKGGEPALEPVRIVEGDVPSARSGDQ 130

Query: 134 ATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDG 193
            T         +  + ++S           +RETP+ VVLTR+AAQ LYAPLRTVEP+ G
Sbjct: 131 PTDADEVPAPANRQAAAQS----------ARRETPISVVLTRFAAQNLYAPLRTVEPLPG 180

Query: 194 IAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEF 253
           + +V + R LDL TL+PTLPV++T L +WRL+D WVTAV+L N  A  ITLDPR L G+F
Sbjct: 181 VMRVNLRRDLDLGTLIPTLPVRATALASWRLEDQWVTAVRLTNTDAGWITLDPRVLQGDF 240

Query: 254 VTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +TA FQH  LG +G   DTT LYL+TRG G+TQ+ + +    DP
Sbjct: 241 LTATFQHEALGPRGTPEDTTVLYLMTRGRGITQSLLPALHRFDP 284
>net:Neut_0089 putative secreted protein
          Length = 300

 Score =  295 bits (755), Expect = 2e-78
 Identities = 158/293 (53%), Positives = 203/293 (69%), Gaps = 16/293 (5%)

Query: 5   RVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTD 64
           RVL G  +L  ++     A AVEILRWERLPLA+PL + QERIVF+D+NVRVG+P S+ +
Sbjct: 6   RVLAGLGVLAWMMAIP--AQAVEILRWERLPLAVPLVVGQERIVFIDRNVRVGVPASMGE 63

Query: 65  KLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGE 124
           +LRVQS GGA+YL A ++IEPTRLQLQ+A TGE+IL+DIAA  A   +PALEPV+IVEG 
Sbjct: 64  RLRVQSAGGAVYLRANESIEPTRLQLQDADTGELILLDIAAQPAKDGEPALEPVQIVEGS 123

Query: 125 TSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAP 184
            +  RYG  A   +  A T S  S+              +RETPVPVVLTR+AAQ LYAP
Sbjct: 124 ITPERYGQQAVGNAIGAQTASAKSS--------------RRETPVPVVLTRHAAQSLYAP 169

Query: 185 LRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITL 244
           LRTVE V GI +V +   L+L TLLPTLP+++  L +WRL+D WVTAV++ +  +  + L
Sbjct: 170 LRTVEAVPGIMRVNLRGDLNLDTLLPTLPIRAVALASWRLEDQWVTAVRVSHINSGWLEL 229

Query: 245 DPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           DPR L G+F+TA FQH  LG  G   DTT +Y+VTRGHGL ++ + +    DP
Sbjct: 230 DPRALQGDFLTATFQHSALGPHGTPEDTTVVYVVTRGHGLAKSLLPAIQRFDP 282
>eba:ebA2409 hypothetical protein
          Length = 305

 Score =  294 bits (753), Expect = 4e-78
 Identities = 165/307 (53%), Positives = 202/307 (65%), Gaps = 19/307 (6%)

Query: 6   VLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDK 65
           VL   A  ++ +G    A AVEILRWERLPLA+PL + QER++F+D+NVR+G+P S+   
Sbjct: 5   VLPALAGFLLSMGLASTARAVEILRWERLPLAVPLVVGQERVIFIDRNVRIGVPESIGAH 64

Query: 66  LRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGET 125
           LRVQS GGAIYL A + I P+RLQLQ+A++G +IL+DIAA  A   QPALEPV+IV  E 
Sbjct: 65  LRVQSAGGAIYLRASEPIPPSRLQLQDAESGALILLDIAAEPAKAGQPALEPVRIVASEW 124

Query: 126 SSARYGGAATARSAKATTKSMDSTSRSNDEDD-EPEEVVKRETPVPVVLTRYAAQMLYAP 184
                        A + T +  STS S DE            TPVPVVLTRYAAQ LYAP
Sbjct: 125 -------------APSPTANPASTSASEDEPSVTASAAAPHATPVPVVLTRYAAQNLYAP 171

Query: 185 LRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITL 244
           LRTVEPV GI +V   RSL L TLLPTLPV++  L AWRL+D WVTAVKL N +A+ + L
Sbjct: 172 LRTVEPVAGIGRVSPRRSLALDTLLPTLPVRAQVLAAWRLEDQWVTAVKLTNTSARWLDL 231

Query: 245 DPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD-----PRA 299
           DPR L G+FV A FQH  LG  G ++DTT +YLVTRGHGL ++ +   AP D     P A
Sbjct: 232 DPRALQGDFVAATFQHTTLGPAGQSADTTVVYLVTRGHGLAESLLPKVAPIDATVNLPPA 291

Query: 300 TRGAKHE 306
             G + E
Sbjct: 292 AAGGQAE 298
>ajs:Ajs_1401 putative secreted protein
          Length = 302

 Score =  294 bits (753), Expect = 4e-78
 Identities = 160/286 (55%), Positives = 203/286 (70%), Gaps = 16/286 (5%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V    +A AVEILRWER+PLA+PL++ QERIVF+D++VRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVAAAPVAHAVEILRWERMPLAVPLKVGQERIVFIDRDVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGETSSARYGG 132
           A+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG ++ ARYG 
Sbjct: 71  AVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGSSTPARYGD 129

Query: 133 -AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPV 191
            A  A  A A  ++   T+R             RETPVPVVLTR+AAQ LYAPLRTVEP+
Sbjct: 130 QAGGADDAPARAQAGARTAR-------------RETPVPVVLTRFAAQNLYAPLRTVEPL 176

Query: 192 DGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMG 251
            G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N +   ITLDPR L G
Sbjct: 177 PGVMRVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNGSGGWITLDPRVLQG 236

Query: 252 EFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +F+TA FQH  LG +G   DTT LYLVTRG GL Q+ + +    DP
Sbjct: 237 DFLTATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRFDP 282
>ajs:Ajs_1259 putative secreted protein
          Length = 302

 Score =  294 bits (753), Expect = 4e-78
 Identities = 160/286 (55%), Positives = 203/286 (70%), Gaps = 16/286 (5%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V    +A AVEILRWER+PLA+PL++ QERIVF+D++VRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVAAAPVAHAVEILRWERMPLAVPLKVGQERIVFIDRDVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGETSSARYGG 132
           A+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG ++ ARYG 
Sbjct: 71  AVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGSSTPARYGD 129

Query: 133 -AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPV 191
            A  A  A A  ++   T+R             RETPVPVVLTR+AAQ LYAPLRTVEP+
Sbjct: 130 QAGGADDAPARAQAGARTAR-------------RETPVPVVLTRFAAQNLYAPLRTVEPL 176

Query: 192 DGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMG 251
            G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N +   ITLDPR L G
Sbjct: 177 PGVMRVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNGSGGWITLDPRVLQG 236

Query: 252 EFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +F+TA FQH  LG +G   DTT LYLVTRG GL Q+ + +    DP
Sbjct: 237 DFLTATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRFDP 282
>rme:Rmet_2350 putative secreted protein
          Length = 303

 Score =  294 bits (753), Expect = 4e-78
 Identities = 155/285 (54%), Positives = 198/285 (69%), Gaps = 13/285 (4%)

Query: 14  MVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGG 73
           ++ V    +A AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P  + ++LRVQS GG
Sbjct: 11  LLAVAAAPVAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG 70

Query: 74  AIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGETSSARYGG 132
           A+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG+++  RYG 
Sbjct: 71  AVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGDSAPGRYGE 129

Query: 133 AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVD 192
            A +  A A  +                   +RETPVPVVLTR+AAQ LYAPLRTVEP+ 
Sbjct: 130 QADSAEAPARAQGQAGA-----------RTARRETPVPVVLTRFAAQNLYAPLRTVEPLP 178

Query: 193 GIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGE 252
           G+ +V + R LDL TL+PTLPV++  L +WRL+D WVTAV+L N  A  + LDPR L G+
Sbjct: 179 GVMRVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNTGADWVALDPRVLQGD 238

Query: 253 FVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           F+TA FQH  LG +G   DTT LYLVT G GL Q+ + +    DP
Sbjct: 239 FLTATFQHEALGPRGTPEDTTVLYLVTGGRGLAQSLLPAIHRFDP 283
>dac:Daci_4176 putative signal peptide
          Length = 312

 Score =  294 bits (752), Expect = 5e-78
 Identities = 160/295 (54%), Positives = 203/295 (68%), Gaps = 18/295 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L G   +   V  +    AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P  + ++L
Sbjct: 11  LLGLLAVAAAVVVSPAVQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERL 70

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGET 125
           RVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG  
Sbjct: 71  RVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGNN 129

Query: 126 SSARYGG---AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           S+ARYG     A A  A+A  ++   T+R             RETP+PVVLTR+AAQ LY
Sbjct: 130 STARYGDQPDGADAPHARAQEQAGTRTAR-------------RETPIPVVLTRFAAQNLY 176

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVE + G+ +V + R LDL TL+PTLP ++  L +WRL+D WVTAV+L N +   I
Sbjct: 177 APLRTVEALPGVMRVNLRRDLDLGTLMPTLPARAVALASWRLEDQWVTAVRLTNSSNDWI 236

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +LDPR L G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP
Sbjct: 237 SLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDP 291
>bpt:Bpet4268 putative secreted protein
          Length = 312

 Score =  294 bits (752), Expect = 5e-78
 Identities = 160/295 (54%), Positives = 203/295 (68%), Gaps = 18/295 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L G   +   V  +    AVEILRWER+PLA+PL++ QERIVF+D+NVRVG+P  + ++L
Sbjct: 11  LLGLLAVAAAVVVSPAVQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERL 70

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPA-LEPVKIVEGET 125
           RVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA E P D  A LEPV+IVEG  
Sbjct: 71  RVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAA-EPPKDGEAELEPVRIVEGNN 129

Query: 126 SSARYGG---AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
           S+ARYG     A A  A+A  ++   T+R             RETP+PVVLTR+AAQ LY
Sbjct: 130 STARYGDQPDGADAPHARAQEQAGTRTAR-------------RETPIPVVLTRFAAQNLY 176

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVE + G+ +V + R LDL TL+PTLP ++  L +WRL+D WVTAV+L N +   I
Sbjct: 177 APLRTVEALPGVMRVNLRRDLDLGTLMPTLPARAVALASWRLEDQWVTAVRLTNSSNDWI 236

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           +LDPR L G+F+TA FQH  LG +G   DTT LYLVTRGHGL Q+ + +    DP
Sbjct: 237 SLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDP 291
>tgr:Tgr7_2856 hypothetical protein
          Length = 295

 Score =  291 bits (745), Expect = 4e-77
 Identities = 156/291 (53%), Positives = 201/291 (69%), Gaps = 21/291 (7%)

Query: 6   VLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDK 65
           VL+  A   + +G    A A+EILRWERLPLA+PL +  ER++F+D+NVRVG+P SL D+
Sbjct: 5   VLSFLATATLTLGLIPSALALEILRWERLPLAVPLVVGHERVIFIDRNVRVGVPASLGDR 64

Query: 66  LRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGET 125
           LRVQS GGA+YL A + IEPTRLQLQ+A TG +IL+DIAA   P + P LEP +I+E E+
Sbjct: 65  LRVQSAGGALYLLASEPIEPTRLQLQDANTGILILLDIAAE--PGEAP-LEPARIIESES 121

Query: 126 SSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPL 185
            + RYG      +A A                    +  RETPVPVVLTRYAAQ LYAPL
Sbjct: 122 HAKRYGDTGQQPAADAA------------------RLPARETPVPVVLTRYAAQSLYAPL 163

Query: 186 RTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLD 245
           RTVEPV+G+ +V + R L L TLLPTLPV++  L AWRL+D WVTA++L N +++ I LD
Sbjct: 164 RTVEPVNGVVRVNLRRDLALDTLLPTLPVRARALAAWRLEDQWVTAIRLTNTSSRWIDLD 223

Query: 246 PRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD 296
           PR L G+FVTA FQHP LG  G++ DT+ +YLVTRG GL Q+ + + +P D
Sbjct: 224 PRALQGDFVTATFQHPDLGPAGDSRDTSVVYLVTRGRGLAQSLLPAISPID 274
>pwa:Pecwa_1629 putative secreted protein
          Length = 300

 Score =  288 bits (737), Expect = 3e-76
 Identities = 158/285 (55%), Positives = 193/285 (67%), Gaps = 15/285 (5%)

Query: 13  LMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTG 72
           LM LV T  +  AVEILRWERLPLA+PL + QERIVFVD+NVRVG+P S+ D+LRVQS G
Sbjct: 13  LMALVQTPAL-HAVEILRWERLPLAVPLSVGQERIVFVDRNVRVGVPASIGDRLRVQSAG 71

Query: 73  GAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGG 132
           GAIYL A + IEPTRLQLQ+A +G +IL+DIAAT A   +PALEP++IVEG  +  RYG 
Sbjct: 72  GAIYLRASEPIEPTRLQLQDADSGALILLDIAATPAKDGEPALEPIRIVEGNATPPRYGQ 131

Query: 133 AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVD 192
                    T               +     +RETPV VVLTRYAAQ LYAPLRT+EPV 
Sbjct: 132 PPDNAPPAPTA--------------DQARPAQRETPVAVVLTRYAAQSLYAPLRTLEPVP 177

Query: 193 GIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGE 252
           GI ++ + R L L TLLPTLPV++  L +WRL+D WVT V+L +     I LDPR L G+
Sbjct: 178 GIMRISLRRDLPLDTLLPTLPVEAKALASWRLEDQWVTVVRLTHTGNGWIELDPRALQGD 237

Query: 253 FVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           F+TA FQH  LG +G+  DTT LYLVTR HGL Q+ + +    DP
Sbjct: 238 FLTATFQHTALGPRGSPEDTTVLYLVTRKHGLPQSLLPAIQRFDP 282
>xac:XAC2272 hypothetical protein
          Length = 330

 Score =  287 bits (735), Expect = 5e-76
 Identities = 146/271 (53%), Positives = 187/271 (69%), Gaps = 4/271 (1%)

Query: 17  VGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIY 76
           +G T  A AV+ILRWER+PLA+P+R+ +ER+VF+D+NVRVG+P ++ D+LRVQS GGAIY
Sbjct: 21  LGDTPTAHAVQILRWERMPLAVPMRVGEERVVFIDRNVRVGVPNAIADRLRVQSAGGAIY 80

Query: 77  LFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATA 136
           L A +AIEPTRLQLQ+A +G ++L+DIAA  A   Q  L PV+I  G+    RYG    A
Sbjct: 81  LKASEAIEPTRLQLQDADSGALVLIDIAAEPAQDGQAPLAPVRIAFGDAPGPRYGAGDRA 140

Query: 137 RSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQ 196
                      + + S D        ++ ETPV VVLTRYAAQ LYAPLRTVE   G+  
Sbjct: 141 SDTDTGYDGQPADALSPDASQR----LRHETPVAVVLTRYAAQSLYAPLRTVESARGVTP 196

Query: 197 VKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTA 256
            ++ R LDL TL P LPV++  L AWRLDD WVTA++L N + + + LDPR L+G+FV A
Sbjct: 197 ARLRRGLDLDTLAPALPVRAQALAAWRLDDQWVTAIRLTNTSPRWVDLDPRMLIGDFVAA 256

Query: 257 AFQHPYLGSQGNASDTTTLYLVTRGHGLTQA 287
            FQHP LG  G+A+DTT LYLVTRG GL +A
Sbjct: 257 TFQHPGLGPAGDATDTTVLYLVTRGRGLGEA 287
>dze:Dd1591_0438 putative signal peptide
          Length = 297

 Score =  279 bits (713), Expect = 2e-73
 Identities = 151/275 (54%), Positives = 186/275 (67%), Gaps = 14/275 (5%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A AVEILRWERLPLA+PL + QERIVFV+ NVRVG+P S+ D+LRVQS GGAIYL A   
Sbjct: 19  AHAVEILRWERLPLAVPLTVGQERIVFVEHNVRVGIPASIGDRLRVQSAGGAIYLRASKP 78

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
           IEPTRLQLQ+  +G +IL+DI A  A   +P LEPV+IVE  T+   Y            
Sbjct: 79  IEPTRLQLQDVDSGALILLDIDAMPAKEGEPKLEPVRIVEDNTTPPHYA----------- 127

Query: 143 TKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERS 202
            + +DS +++     EP+   + ETPV VVLTRYAAQ LYAPLRTVEPV GI +V +  +
Sbjct: 128 -QQLDSATKT--PITEPDRPTQHETPVAVVLTRYAAQNLYAPLRTVEPVPGIMRVNLRHN 184

Query: 203 LDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPY 262
           L   TLLPTLPV++T L +WRL+D WVTAV+L +     I LDPR L G+F+ A FQH  
Sbjct: 185 LPFDTLLPTLPVQATALVSWRLEDQWVTAVRLTHTEGGWIRLDPRTLQGDFLAATFQHAA 244

Query: 263 LGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           LG  G   DTT LYLVTR HGL+Q+ + +    DP
Sbjct: 245 LGPHGTPEDTTVLYLVTRKHGLSQSLLPAIQRVDP 279
>pfs:PFLU1930 hypothetical protein
          Length = 270

 Score =  268 bits (686), Expect = 2e-70
 Identities = 153/298 (51%), Positives = 191/298 (64%), Gaps = 36/298 (12%)

Query: 9   GSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRV 68
           G  + ++L G    A AVE++RWERLPLA+PL INQER+VFVD++VRVG+P +LTDKLRV
Sbjct: 8   GLTIALMLWGAA--AQAVELMRWERLPLAVPLVINQERVVFVDEDVRVGVPSTLTDKLRV 65

Query: 69  QSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSA 128
           QSTGG +YL A +AI PTRLQLQ+  TGEIIL+DIAAT  P DQP LEPV+I++     A
Sbjct: 66  QSTGGTLYLRASEAIAPTRLQLQSVATGEIILLDIAAT--PGDQP-LEPVRILKNVPVQA 122

Query: 129 RYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTV 188
                                     E +     V   TP+PV LTRYAAQ LYAPLRTV
Sbjct: 123 T-------------------------ETESSTVPVPERTPIPVALTRYAAQSLYAPLRTV 157

Query: 189 EPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRE 248
           E + G+ +V ++   +L TLLPT  V STP+ AWRL D+WVTAVKL+N+ +  + LDPR+
Sbjct: 158 ESLPGVRRVPLKLRTELPTLLPTENVSSTPIAAWRLGDYWVTAVKLRNRGSGTVQLDPRQ 217

Query: 249 LMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRATRGAKHE 306
           +      AAFQH +LG  G+A DTT  YLVTRG GL +A +       P   RGA  E
Sbjct: 218 IQATLFAAAFQHAFLGPVGSAEDTTLAYLVTRGAGLEKAVLL------PPVARGADDE 269
>pfo:Pfl01_3020 hypothetical protein
          Length = 268

 Score =  262 bits (670), Expect = 2e-68
 Identities = 150/298 (50%), Positives = 191/298 (64%), Gaps = 35/298 (11%)

Query: 9   GSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRV 68
           G  + ++L G    A AVE++ WERLPLA+PL INQER+VFVD+NVRVG+P +LT KLRV
Sbjct: 5   GLTVALMLWGAA--AQAVELMHWERLPLAVPLVINQERVVFVDENVRVGVPSTLTGKLRV 62

Query: 69  QSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSA 128
           QSTGG +YL A ++I PTRLQLQ+  TGEIIL+DIAAT  P DQP LEPV+I++      
Sbjct: 63  QSTGGTLYLRASESIAPTRLQLQSVTTGEIILLDIAAT--PGDQP-LEPVRILKN----- 114

Query: 129 RYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTV 188
                A  ++A+A + ++                V   TP+PV LTRYAAQ LY PLRTV
Sbjct: 115 -----AQEQAAEAVSSTVP---------------VPERTPIPVALTRYAAQSLYGPLRTV 154

Query: 189 EPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRE 248
           E + G+ +V ++   +L  LLPT  V S P+ AWRL D+WVTAVKL+N+  + + LDPR 
Sbjct: 155 ESLPGVRRVPLKLRTELPALLPTENVSSMPIAAWRLGDYWVTAVKLRNRGLETVQLDPRR 214

Query: 249 LMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRATRGAKHE 306
           L  +   AAFQH +LG  G+A DTT  YLVTRG GL  A +       P   RGA  E
Sbjct: 215 LQAKLFAAAFQHAFLGPVGSAEDTTIAYLVTRGAGLEHAVLL-----PPPVARGASDE 267
>spe:Spro_4089 hypothetical protein
          Length = 305

 Score =  243 bits (620), Expect = 1e-62
 Identities = 139/302 (46%), Positives = 184/302 (60%), Gaps = 9/302 (2%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+ S L +  + T  +A A E+++WER+PL IPL + +ER++F D+NVRVG P +L  KL
Sbjct: 9   LSLSVLPLAAMFTVPVAQAEELMKWERIPLQIPLAVGKERVLFADKNVRVGFPPALNGKL 68

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGET 125
           RVQS+GGA+YL A  A  PTRLQLQ+ + GE+IL+D+AA+    D+ + EPV+IV  G+ 
Sbjct: 69  RVQSSGGAVYLKADSAFPPTRLQLQDVENGEVILLDVAAS----DKGSAEPVRIVYSGDV 124

Query: 126 SSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPL 185
           SS     +    S+     S  +   ++D      + +K   P+PVVLTRYAAQ LY P+
Sbjct: 125 SSV--SSSNDTSSSSVGNSSGSAAPGADDGTQAKRKKIKYNAPLPVVLTRYAAQSLYGPV 182

Query: 186 RTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLD 245
           RTVE V GI  V       + TL P+ PV  TPLG W +    V A+K+QN  +++ITLD
Sbjct: 183 RTVEAVPGIHPVNPHLPKRITTLYPSEPVAITPLGGWGIGSRNVVALKVQNTASRKITLD 242

Query: 246 PRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGH--GLTQATVFSAAPADPRATRGA 303
           PR L G+FVTA FQH YLG  G   DTTTLYLVT G   G   A       A   A +GA
Sbjct: 243 PRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSVVRKAVKAAKKGA 302

Query: 304 KH 305
            H
Sbjct: 303 NH 304
>pwa:Pecwa_0657 hypothetical protein
          Length = 298

 Score =  239 bits (609), Expect = 2e-61
 Identities = 132/275 (48%), Positives = 177/275 (64%), Gaps = 6/275 (2%)

Query: 24  SAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDAI 83
           SA+E+++WER+PL IPL + QERIVFVD+NVRVG P SL+ KLRVQS+GG++YL A +  
Sbjct: 19  SALELMKWERIPLQIPLNVGQERIVFVDKNVRVGFPPSLSGKLRVQSSGGSVYLSASEPF 78

Query: 84  EPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARYGGAATARSAKAT 142
             TRLQLQ+ + GE++L+DI+A E    +   EPV++V  GE SS      A   S  + 
Sbjct: 79  SSTRLQLQDVENGEVLLLDISAVEG---KSVREPVQVVYAGEVSSVSTNDNAKV-SGSSN 134

Query: 143 TKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERS 202
             S  S+SR + +  E    V    PVPV+LTRYAAQ LYAPLRTVEPV GI  V ++  
Sbjct: 135 KASHPSSSRESADKAERHSPVS-SVPVPVLLTRYAAQSLYAPLRTVEPVPGIGTVSLKLP 193

Query: 203 LDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPY 262
             + TL P+ PV + PL  WRL++F V A++++N ++ ++ LDPR L G FV+A FQH +
Sbjct: 194 SPITTLFPSEPVVAVPLAGWRLNNFSVIALQIRNTSSGKVILDPRRLQGRFVSATFQHRW 253

Query: 263 LGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADP 297
           LGS G   DTT +YLV  G   +        PA P
Sbjct: 254 LGSAGTPEDTTVVYLVIDGQPESAFLPEPVIPAKP 288
>pmr:PMI2580 hypothetical protein
          Length = 298

 Score =  238 bits (608), Expect = 3e-61
 Identities = 135/305 (44%), Positives = 188/305 (61%), Gaps = 17/305 (5%)

Query: 1   MRILRVLTGSALLMVLVGTTQI----ASAVEILRWERLPLAIPLRINQERIVFVDQNVRV 56
           M I R LT  AL +  V +         AVE++RWER+PL + L + +ERIVFV++NVRV
Sbjct: 1   MSIKRHLTACALGISAVFSVAALPLPVQAVELVRWERIPLPVSLHVGEERIVFVEKNVRV 60

Query: 57  GLPRSLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALE 116
           G P SL +KLR+QSTGGA+YL A+ A   TRLQLQ+ ++GEI+L+D+ AT     +  LE
Sbjct: 61  GFPPSLNEKLRIQSTGGAVYLRAESAFPQTRLQLQDVESGEILLLDVTATAG---KGKLE 117

Query: 117 PVKIVEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRY 176
           PV++V     S +    +  RS +A   + D+   S D   +     +   P+PV+LTRY
Sbjct: 118 PVRVVYSGEVSTQRDSQSVRRSGQAAGAAADAVPESVDRKAK----TRYPAPLPVLLTRY 173

Query: 177 AAQMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQN 236
           AAQ LYAPLRTVEPV G+  + +     L  L P+ P+ + PL  W+  ++ V AVKL N
Sbjct: 174 AAQSLYAPLRTVEPVSGVQPLPLTLPKTLTALYPSEPLIARPLAGWQAAEYRVVAVKLTN 233

Query: 237 QTAQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD 296
           Q+AQ++ LDPR+L G+FV+A FQH +L ++G   DTTT+YLV +G          A PA+
Sbjct: 234 QSAQKVVLDPRQLQGQFVSATFQHQWLDAKGTPEDTTTVYLVMKG------KPDKAFPAE 287

Query: 297 PRATR 301
           P   R
Sbjct: 288 PPVRR 292
>spq:SPAB_05383 hypothetical protein
          Length = 299

 Score =  238 bits (607), Expect = 4e-61
 Identities = 129/275 (46%), Positives = 179/275 (65%), Gaps = 12/275 (4%)

Query: 10  SALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQ 69
           S +L+ LV  +  A AVE+++WER+PL IPL + QERIVFV++NVRVG P +L DKLR+Q
Sbjct: 5   SVILLTLVLVSAGARAVELMKWERIPLQIPLTVGQERIVFVNKNVRVGFPPALNDKLRIQ 64

Query: 70  STGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSA 128
           S+GG +YL AK+A   TRL+LQN + GEI+L+D++A      +   EPVKIV +GE ++A
Sbjct: 65  SSGGVVYLDAKEAFPVTRLELQNKENGEILLLDVSAAPGKSTR---EPVKIVYDGEVATA 121

Query: 129 RYGGAATARSAKATTKSMDSTSRSNDEDDEPEE--VVKRETPVPVVLTRYAAQMLYAPLR 186
                 +A   +  +   DS  R +  + + E     K   P+PVVLTRYAAQ +Y PLR
Sbjct: 122 ------SATDKQTVSSDGDSAGRQSSAEAKAESRRPAKLNAPLPVVLTRYAAQNMYGPLR 175

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
           TVEPV G++ V ++    + TL+P+  V  TP+ AW L    V A++++N+ A ++ LDP
Sbjct: 176 TVEPVPGVSPVSLKLPPRITTLMPSESVSVTPMAAWSLQGSSVIALQVRNRAAVKVILDP 235

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRG 281
           R L G+F TA FQH +LG  G   DTT LYLVT G
Sbjct: 236 RSLQGQFTTATFQHRWLGRAGTPEDTTVLYLVTAG 270
>epy:EpC_31960 conserved uncharacterized protein
          Length = 287

 Score =  238 bits (606), Expect = 5e-61
 Identities = 138/296 (46%), Positives = 188/296 (63%), Gaps = 18/296 (6%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           +L+ L+ T+  A AVE+++WER+PL IPL + QERIVFV++NVRVG P  L +KLR+QS+
Sbjct: 7   ILLALLLTSGAARAVELMKWERIPLQIPLTVGQERIVFVNKNVRVGFPSVLNNKLRIQSS 66

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARY 130
           GG +YL A +A   TRL+LQN + GEIIL+D++A      +   EPVKIV +GE      
Sbjct: 67  GGVVYLAASEAFAVTRLELQNKENGEIILLDVSAEPGKATR---EPVKIVCDGEV----- 118

Query: 131 GGAATARSAKATTKSMDSTSRSNDEDDEP--EEVVKRETPVPVVLTRYAAQMLYAPLRTV 188
              A A ++   T S D ++R    DD     +  K   P+PVVLTRYAAQ +Y PLRTV
Sbjct: 119 ---ANASASDKQTVSGDGSARQPPSDDAQASRKPAKLNAPLPVVLTRYAAQNMYGPLRTV 175

Query: 189 EPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRE 248
           E V GI+ V ++    + TL+P+  V  TP+ AW L    V A++++N+ A ++ LDPR 
Sbjct: 176 EAVPGISPVSLKLPSAITTLMPSEAVSVTPMAAWSLQGSSVIALQVRNRAADKVILDPRV 235

Query: 249 LMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRATRGAK 304
           L G+FVTA FQH +LGS G   DTT LYLVT G      + F A PA  +++R AK
Sbjct: 236 LEGQFVTATFQHRWLGSSGTPEDTTVLYLVTAGRA---ESAFIAEPA-VKSSRRAK 287
>epy:EpC_30340 conserved uncharacterized protein
          Length = 287

 Score =  238 bits (606), Expect = 5e-61
 Identities = 138/296 (46%), Positives = 188/296 (63%), Gaps = 18/296 (6%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           +L+ L+ T+  A AVE+++WER+PL IPL + QERIVFV++NVRVG P  L +KLR+QS+
Sbjct: 7   ILLALLLTSGAARAVELMKWERIPLQIPLTVGQERIVFVNKNVRVGFPSVLNNKLRIQSS 66

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARY 130
           GG +YL A +A   TRL+LQN + GEIIL+D++A      +   EPVKIV +GE      
Sbjct: 67  GGVVYLAASEAFAVTRLELQNKENGEIILLDVSAEPGKATR---EPVKIVCDGEV----- 118

Query: 131 GGAATARSAKATTKSMDSTSRSNDEDDEP--EEVVKRETPVPVVLTRYAAQMLYAPLRTV 188
              A A ++   T S D ++R    DD     +  K   P+PVVLTRYAAQ +Y PLRTV
Sbjct: 119 ---ANASASDKQTVSGDGSARQPPSDDAQASRKPAKLNAPLPVVLTRYAAQNMYGPLRTV 175

Query: 189 EPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRE 248
           E V GI+ V ++    + TL+P+  V  TP+ AW L    V A++++N+ A ++ LDPR 
Sbjct: 176 EAVPGISPVSLKLPSAITTLMPSEAVSVTPMAAWSLQGSSVIALQVRNRAADKVILDPRV 235

Query: 249 LMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRATRGAK 304
           L G+FVTA FQH +LGS G   DTT LYLVT G      + F A PA  +++R AK
Sbjct: 236 LEGQFVTATFQHRWLGSSGTPEDTTVLYLVTAGRA---ESAFIAEPA-VKSSRRAK 287
>sei:SPC_4425 hypothetical protein
          Length = 299

 Score =  237 bits (605), Expect = 6e-61
 Identities = 138/287 (48%), Positives = 177/287 (61%), Gaps = 18/287 (6%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A AVE+++WER+PL IPL +N ERIVFVD+NVRVG P  L  KLRVQS+GG +YL A + 
Sbjct: 25  AQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGFPAMLKGKLRVQSSGGTVYLQASEP 84

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
            E TRLQLQ+ ++GEIIL+DIAA     D  ALEPV++V        Y G   + S K  
Sbjct: 85  FEQTRLQLQDVESGEIILLDIAAKN---DNKALEPVRLV--------YSGEVLSVSEKGM 133

Query: 143 TKSMDSTSRSNDEDDEPEEVVKR---ETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKV 199
                    S D +D+ + V K      P+PVVLTRYAAQ LYAPLRTVE V GI  V +
Sbjct: 134 ETGSSLPVASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVNL 193

Query: 200 ERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQ 259
                L TL P+  V  +P+GAW + +  V A+K++N+++ ++ LD R L G FV+A FQ
Sbjct: 194 RLPSRLTTLYPSENVVVSPIGAWGIQELNVVALKIRNRSSSKVILDARTLSGSFVSATFQ 253

Query: 260 HPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD-PRATRGAKH 305
           H +LG+ G   DTTTLYLV RG        F A PA  P   +G +H
Sbjct: 254 HRWLGAAGTPEDTTTLYLVIRGR---PENAFIAEPAVLPAVKKGEQH 297
>stt:t4266 hypothetical protein
          Length = 299

 Score =  237 bits (605), Expect = 6e-61
 Identities = 138/287 (48%), Positives = 177/287 (61%), Gaps = 18/287 (6%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A AVE+++WER+PL IPL +N ERIVFVD+NVRVG P  L  KLRVQS+GG +YL A + 
Sbjct: 25  AQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGFPAMLKGKLRVQSSGGTVYLQASEP 84

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
            E TRLQLQ+ ++GEIIL+DIAA     D  ALEPV++V        Y G   + S K  
Sbjct: 85  FEQTRLQLQDVESGEIILLDIAAKN---DNKALEPVRLV--------YSGEVLSVSEKGM 133

Query: 143 TKSMDSTSRSNDEDDEPEEVVKR---ETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKV 199
                    S D +D+ + V K      P+PVVLTRYAAQ LYAPLRTVE V GI  V +
Sbjct: 134 ETGSSLPVASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVNL 193

Query: 200 ERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQ 259
                L TL P+  V  +P+GAW + +  V A+K++N+++ ++ LD R L G FV+A FQ
Sbjct: 194 RLPSRLTTLYPSENVVVSPIGAWGIQELNVVALKIRNRSSSKVILDARTLSGSFVSATFQ 253

Query: 260 HPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD-PRATRGAKH 305
           H +LG+ G   DTTTLYLV RG        F A PA  P   +G +H
Sbjct: 254 HRWLGAAGTPEDTTTLYLVIRGR---PENAFIAEPAVLPAVKKGEQH 297
>sty:STY4569 hypothetical protein
          Length = 299

 Score =  237 bits (605), Expect = 6e-61
 Identities = 138/287 (48%), Positives = 177/287 (61%), Gaps = 18/287 (6%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A AVE+++WER+PL IPL +N ERIVFVD+NVRVG P  L  KLRVQS+GG +YL A + 
Sbjct: 25  AQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGFPAMLKGKLRVQSSGGTVYLQASEP 84

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
            E TRLQLQ+ ++GEIIL+DIAA     D  ALEPV++V        Y G   + S K  
Sbjct: 85  FEQTRLQLQDVESGEIILLDIAAKN---DNKALEPVRLV--------YSGEVLSVSEKGM 133

Query: 143 TKSMDSTSRSNDEDDEPEEVVKR---ETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKV 199
                    S D +D+ + V K      P+PVVLTRYAAQ LYAPLRTVE V GI  V +
Sbjct: 134 ETGSSLPVASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLRTVEAVPGIHPVNL 193

Query: 200 ERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQ 259
                L TL P+  V  +P+GAW + +  V A+K++N+++ ++ LD R L G FV+A FQ
Sbjct: 194 RLPSRLTTLYPSENVVVSPIGAWGIQELNVVALKIRNRSSSKVILDARTLSGSFVSATFQ 253

Query: 260 HPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPAD-PRATRGAKH 305
           H +LG+ G   DTTTLYLV RG        F A PA  P   +G +H
Sbjct: 254 HRWLGAAGTPEDTTTLYLVIRGR---PENAFIAEPAVLPAVKKGEQH 297
>spe:Spro_0334 hypothetical protein
          Length = 303

 Score =  236 bits (601), Expect = 2e-60
 Identities = 136/306 (44%), Positives = 182/306 (59%), Gaps = 19/306 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+ S L +  + T  +A A E+++WER+PL IPL + +ER++F D+NVRVG P +L  KL
Sbjct: 9   LSLSVLPLAAMFTVPVAQAEELMKWERIPLQIPLAVGKERVLFADKNVRVGFPPALNGKL 68

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS+GGA+YL A     PTRLQLQ+ + GE+IL+D+ A    +D+ + EPV+IV     
Sbjct: 69  RVQSSGGAVYLKADSVFPPTRLQLQDVENGEVILLDVTA----LDKGSAEPVRIV----- 119

Query: 127 SARYGGAATARSAKATTKSMDSTSRS-----NDEDDEPEEVVKRETPVPVVLTRYAAQML 181
              Y G  ++ S+   T S+ ++S S     +D      + +K   P+PVVLTRYAAQ L
Sbjct: 120 ---YSGDVSSVSSSNDTSSVGNSSGSAAPGADDGTQAKRKKIKYNAPLPVVLTRYAAQSL 176

Query: 182 YAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQR 241
           Y P+RTVE V  I  V       + TL P+ PV   PLG W +    V A+K+QN  +++
Sbjct: 177 YGPVRTVEAVPSIHPVNPHLPKRITTLYPSEPVAIAPLGGWGIGSRNVVALKVQNTASRK 236

Query: 242 ITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGH--GLTQATVFSAAPADPRA 299
           ITLDPR L G+FVTA FQH YLG  G   DTTTLYLVT G   G   A       A    
Sbjct: 237 ITLDPRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSVVRKAVKAV 296

Query: 300 TRGAKH 305
            +GA H
Sbjct: 297 KKGANH 302
>yen:YE3485 hypothetical protein
          Length = 288

 Score =  235 bits (600), Expect = 2e-60
 Identities = 130/261 (49%), Positives = 168/261 (64%), Gaps = 15/261 (5%)

Query: 22  IASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKD 81
           + SAVE+++WER+PL IPL + QERIVFVD+NVRVG P +L  KLRVQS+GGA+YL A +
Sbjct: 17  VVSAVELMKWERIPLQIPLNVGQERIVFVDKNVRVGFPPTLNGKLRVQSSGGAVYLSASE 76

Query: 82  AIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARYGGAATARSAK 140
               TRLQLQN   GEIIL+D++AT     +   EPV++V +GE SSA            
Sbjct: 77  TFPVTRLQLQNKANGEIILLDVSATAG---KSIREPVQLVYDGEVSSA-----------S 122

Query: 141 ATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVE 200
            + K+  S +       E  +  K  TP+PVVLTRYAAQ LY PLRTVEPV GI    ++
Sbjct: 123 TSDKTRISGNEQTAAISERRKPAKLNTPLPVVLTRYAAQSLYGPLRTVEPVVGITNTALK 182

Query: 201 RSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQH 260
               L TL P+ PV+ +PL  W L+ + V A+ ++N     + L+PR L GEF++AAFQH
Sbjct: 183 LPSRLTTLYPSEPVEVSPLVGWSLNGYSVIALLVRNTATVNVILNPRMLQGEFISAAFQH 242

Query: 261 PYLGSQGNASDTTTLYLVTRG 281
           P+LGS G   DTT LYLV RG
Sbjct: 243 PWLGSAGMPEDTTVLYLVVRG 263
>elf:LF82_p685 hypothetical protein
          Length = 291

 Score =  235 bits (599), Expect = 3e-60
 Identities = 139/306 (45%), Positives = 185/306 (60%), Gaps = 21/306 (6%)

Query: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60
           M + R L   A L  L      A AVE+++WER+PL + L +NQERIVFV++NVRVG P 
Sbjct: 1   MSLRRFLLSLACLAALP-----AQAVELVKWERIPLPVALHVNQERIVFVNRNVRVGFPP 55

Query: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120
            L  KLRVQSTGGA+YL   +    TRL LQ+ + GE+IL+DI+A E    +  LEPV +
Sbjct: 56  ELKGKLRVQSTGGAVYLQPGEQFARTRLVLQDVENGEMILLDISAEEG---KNVLEPVSL 112

Query: 121 V-EGETSSARYGG-AATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAA 178
           V +GE SS+   G  A   +  ATT    STS+  ++        K  TP+PV LTRYAA
Sbjct: 113 VYQGEVSSSMGDGDVAVTDNKTATTGERQSTSKLKEK--------KSTTPLPVALTRYAA 164

Query: 179 QMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQT 238
           Q LYAP RT+EP+ G+  + +     L +LLP+  V+  PL AW L  + V A+ L+NQ 
Sbjct: 165 QSLYAPSRTIEPLPGVHSISLALPDKLTSLLPSESVEVRPLAAWGLQGYSVVALTLRNQR 224

Query: 239 AQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPR 298
           A+++ LDPR L G F +A FQH +LG+ G   DTTT+YLVT+G      T F   P   +
Sbjct: 225 AEKVILDPRRLQGNFYSATFQHRWLGASGTPEDTTTVYLVTKGR---PDTAFLPEPVKAK 281

Query: 299 ATRGAK 304
           A +G K
Sbjct: 282 AGKGGK 287
>ypz:YPZ3_0316 hypothetical protein
          Length = 303

 Score =  234 bits (596), Expect = 7e-60
 Identities = 135/302 (44%), Positives = 184/302 (60%), Gaps = 11/302 (3%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+ S L +    T  +A A E+++WER+PL IPL + +ER++F D+NVRVG P +L  KL
Sbjct: 9   LSLSVLPLAATFTVPVAQAEELMKWERIPLQIPLVVGKERVLFADKNVRVGFPPALNGKL 68

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGET 125
           RVQS+GGA+YL A  A  PTRLQLQ+ + GE+IL+D+ A+    D+ + EPV+IV  G+ 
Sbjct: 69  RVQSSGGAVYLKADAAFPPTRLQLQDVENGEVILLDVTAS----DKGSAEPVRIVYSGDV 124

Query: 126 SSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPL 185
           SS     +++  +A ++  S  +   + +      + +K   P+PVVLTRYAAQ LY P+
Sbjct: 125 SSI----SSSNDTATSSAGSPSAAPGAENGTQAKRKKIKYNAPLPVVLTRYAAQSLYGPV 180

Query: 186 RTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLD 245
           RTVE V GI  V       + TL P+ PV  TPLG W +    V A+ +QN  +++ITLD
Sbjct: 181 RTVEAVPGIHPVNPHLPKRITTLYPSEPVAITPLGGWGIGSRNVVALMVQNTASRKITLD 240

Query: 246 PRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGH--GLTQATVFSAAPADPRATRGA 303
           PR L G+FVTA FQH YLG  G   DT+TLYLVT G   G   A       A   A +GA
Sbjct: 241 PRMLQGQFVTATFQHRYLGPVGTPEDTSTLYLVTAGRPDGAFVAEPSVVRKAVKAAKKGA 300

Query: 304 KH 305
            H
Sbjct: 301 NH 302
>spe:Spro_4172 hypothetical protein
          Length = 303

 Score =  233 bits (593), Expect = 2e-59
 Identities = 138/306 (45%), Positives = 179/306 (58%), Gaps = 19/306 (6%)

Query: 7   LTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKL 66
           L+ S L +    T  +  A E+++WER+PL IPL + +ER++F D+NVRVG P +L  KL
Sbjct: 9   LSLSVLPLAATFTVPVTQAEELMKWERIPLQIPLTVGKERVLFADKNVRVGFPPALNGKL 68

Query: 67  RVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETS 126
           RVQS+GGA+YL A  A   TRLQLQ+ + GE+IL+D+ A+    D+ + EPV+IV     
Sbjct: 69  RVQSSGGAVYLKADAAFPSTRLQLQDVENGEVILLDVTAS----DKGSAEPVRIV----- 119

Query: 127 SARYGGAATARSAKATTKSMDSTSRS-----NDEDDEPEEVVKRETPVPVVLTRYAAQML 181
              Y G  ++ S+   T S  S S S      D      + V+   P+PVVLTRYAAQ L
Sbjct: 120 ---YSGDVSSVSSSNDTPSPSSASSSAAPGTEDGTQAKRKKVRYNAPLPVVLTRYAAQSL 176

Query: 182 YAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQR 241
           Y P+RTVE V GI  V       + TL P+  V  TPLG W +    V A+K+QN  +++
Sbjct: 177 YGPVRTVEAVPGIHPVNPHLPKRITTLYPSESVAITPLGGWGIGSRNVVALKVQNTASRK 236

Query: 242 ITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGH--GLTQATVFSAAPADPRA 299
           ITLDPR L G+FVTA FQH YLG  G   DTTTLYLVT G   G   A       A   A
Sbjct: 237 ITLDPRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSVVRKAVKAA 296

Query: 300 TRGAKH 305
            +GA H
Sbjct: 297 KKGANH 302
>ypi:YpsIP31758_3708 hypothetical protein
          Length = 288

 Score =  233 bits (593), Expect = 2e-59
 Identities = 130/265 (49%), Positives = 167/265 (63%), Gaps = 23/265 (8%)

Query: 22  IASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKD 81
           + SAVE+++WER+PL IPL + QERIVFVD+NVRVG P +L  KLRVQS+GGA+YL A +
Sbjct: 17  VVSAVELMKWERIPLQIPLNVGQERIVFVDKNVRVGFPPTLNGKLRVQSSGGAVYLSASE 76

Query: 82  AIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARYGGAATARSAK 140
           A   TRLQLQN   GEIIL+D++A      +   EPV++V +GE SSA            
Sbjct: 77  AFPVTRLQLQNKANGEIILLDVSAAPG---KSIREPVQLVYDGEVSSA------------ 121

Query: 141 ATTKSMDSTSRSNDED----DEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQ 196
               + D T  S +E      E  +  K  TP+PVVLTRYAAQ LY PLRTVEPV  I  
Sbjct: 122 ---STSDKTRISGNEQTAVISERRKPAKLNTPLPVVLTRYAAQSLYGPLRTVEPVVSITN 178

Query: 197 VKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTA 256
             ++    L TL P+ PV+ +PL  W L+ + V A+ ++N     + L+PR L GEF++A
Sbjct: 179 TALKLPSRLTTLYPSEPVEVSPLAGWSLNGYSVIALLVRNTATVNVILNPRMLQGEFISA 238

Query: 257 AFQHPYLGSQGNASDTTTLYLVTRG 281
           AFQHP+LG  G   DTT LYLV RG
Sbjct: 239 AFQHPWLGKAGTPEDTTVLYLVVRG 263
>plu:plu1082 hypothetical protein
          Length = 307

 Score =  231 bits (590), Expect = 3e-59
 Identities = 123/279 (44%), Positives = 169/279 (60%), Gaps = 3/279 (1%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           ++ +L  +ALL   +       AVE+++WER+PL + L + QER+VFVD+NVRVG P +L
Sbjct: 6   LVELLALTALLFAGLVMVSPVEAVELMKWERIPLPVALHVGQERVVFVDKNVRVGFPGAL 65

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVE 122
             KLR+QSTGGA+YL+  +    TRLQLQ+ ++GE+IL+D+ AT     +  LEPV++V 
Sbjct: 66  DGKLRIQSTGGAVYLYPSETFTQTRLQLQDVESGEVILLDVTATNG---KDPLEPVRVVY 122

Query: 123 GETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
                           AK    S  S S + +      +      P+PVVLTRYAAQ LY
Sbjct: 123 HGDVITLTDDHQIHHGAKGDNTSATSPSLAGERQAARRQKPSYTAPLPVVLTRYAAQSLY 182

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTVE V GI  V +  S  L TL P+ PV  +PLG W +D+  V A+K++N   + +
Sbjct: 183 APLRTVEAVPGIHPVSLALSPRLTTLYPSAPVIVSPLGGWGVDNLTVVALKVRNTHRENV 242

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRG 281
            LDPR L G+F+ A FQH +LG  G   DTTT+YLV +G
Sbjct: 243 VLDPRRLQGQFIAATFQHRWLGPSGTPEDTTTVYLVVKG 281
>ses:SARI_03120 hypothetical protein
          Length = 260

 Score =  231 bits (589), Expect = 4e-59
 Identities = 123/283 (43%), Positives = 173/283 (61%), Gaps = 32/283 (11%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           LL++LV       AV++++WER+PL + L   QERI+FVD+NVRVG P +L  KLR+QS+
Sbjct: 6   LLILLVALP--LHAVKLVKWERIPLPVALNTGQERIIFVDRNVRVGYPAALEGKLRIQSS 63

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYG 131
            G +YL A      TRLQLQ+ + GE+IL+D++A++    +   EP++IV  E  +    
Sbjct: 64  NGTLYLLASQPFAATRLQLQDTENGELILLDVSASKG---EHIREPIRIVREEKKTP--- 117

Query: 132 GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPV 191
                                   D +P+ V +  TP+PV LTRYAAQMLYAPLRTVEP+
Sbjct: 118 ------------------------DAKPDAVPEPSTPLPVALTRYAAQMLYAPLRTVEPL 153

Query: 192 DGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMG 251
            G+    V  +  + TLLP LPV + P+G W+LD + + A++LQN++  R+ LDPR+L G
Sbjct: 154 PGVQPEGVRLAKTITTLLPALPVSAIPIGGWKLDHYHLAAIRLQNKSTTRLELDPRQLQG 213

Query: 252 EFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAP 294
            F  A+FQH +LG  G+A DTT LYL+T  H   QA +   AP
Sbjct: 214 RFYAASFQHRWLGPAGSAEDTTVLYLITHNHRPEQAILPEPAP 256
>ppw:PputW619_3327 hypothetical protein
          Length = 268

 Score =  231 bits (588), Expect = 6e-59
 Identities = 137/304 (45%), Positives = 178/304 (58%), Gaps = 37/304 (12%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           ++RVL    +L V  G      AVE+  W+RLPLA+PL + QER++ +D++VRVG+P ++
Sbjct: 1   MMRVLI--MILTVAAGWCSAVGAVEVKYWDRLPLAVPLTVGQERVLMLDEDVRVGVPGTI 58

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVE 122
             KLRVQS GG +YL A +A+ PTRLQLQ+ K+G+IIL+DI A E      ALEPVKIV 
Sbjct: 59  AGKLRVQSVGGTVYLRAAEALPPTRLQLQSVKSGDIILIDIEALEG---SEALEPVKIV- 114

Query: 123 GETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
                           A+A+   +++           +E     TPVPVVLTRYAAQ LY
Sbjct: 115 ----------------AQASAPDVEAA----------KEAAPAATPVPVVLTRYAAQNLY 148

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTV P+ G+ +V +  S+  ++LLPT  V    L AWRL D+WVTAVK+ N+   ++
Sbjct: 149 APLRTVAPLPGVRRVPLSDSVAFSSLLPTERVSIKALAAWRLGDYWVTAVKIVNRGPGKV 208

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRATRG 302
            LDPR L      A FQH  LG  G   DTT  YLVTRG  L  A +    P  P A   
Sbjct: 209 VLDPRHLQATLFAATFQHSDLGFTGTPEDTTVAYLVTRGGDLKHALLL--PPPTPEA--- 263

Query: 303 AKHE 306
           A HE
Sbjct: 264 ADHE 267
>ppf:Pput_2945 hypothetical protein
          Length = 268

 Score =  230 bits (586), Expect = 1e-58
 Identities = 135/297 (45%), Positives = 176/297 (59%), Gaps = 34/297 (11%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           ++RVL    +L V  G      AVE+  W+RLPLA+PL + QERI+ +D++VRVG+P ++
Sbjct: 1   MMRVLI--MMLAVAAGWCSAVGAVEVKYWDRLPLAVPLTVGQERILMLDEDVRVGVPGTI 58

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVE 122
             KLRVQS GG +YL A +A+ PTRLQLQ+ K+G+IIL+DI A E      ALEPVKIV 
Sbjct: 59  AGKLRVQSVGGTVYLRAAEALPPTRLQLQSVKSGDIILIDIEALEG---SEALEPVKIV- 114

Query: 123 GETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLY 182
                           A+A+   +++           ++     TPVPVVLTRYAAQ LY
Sbjct: 115 ----------------AQASAPDVEAA----------KDAAPAATPVPVVLTRYAAQNLY 148

Query: 183 APLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRI 242
           APLRTV P+ G+ +V +  ++  ++LLPT  V    L AWRL D+WVTAVK+ N+   +I
Sbjct: 149 APLRTVGPLPGVRRVPLSDAVAFSSLLPTERVSIKALAAWRLGDYWVTAVKIVNRGPGKI 208

Query: 243 TLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPRA 299
           TLDPR L      A FQH  LG  G   DTT  YLVTRG  L  A +    P  P A
Sbjct: 209 TLDPRHLQATLYAATFQHADLGLAGTPEDTTVAYLVTRGGDLRHALLL--PPPKPEA 263
>xbo:XBJ1_1528 hypothetical protein
          Length = 278

 Score =  229 bits (585), Expect = 1e-58
 Identities = 131/260 (50%), Positives = 166/260 (63%), Gaps = 29/260 (11%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A A E+++WER+PL + L++ QERI+F D+NVRVGL  SL+DKLRVQS GGA+YL A  A
Sbjct: 26  AKADELMKWERIPLPVTLKVCQERIIFADRNVRVGLSPSLSDKLRVQSAGGAVYLKASHA 85

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARYGGAATARSAKA 141
             PTRLQLQ+++ GEIIL+DI AT+      + EPV+I+   E SSA   GA   R    
Sbjct: 86  FSPTRLQLQDSENGEIILLDITATKTG----STEPVRILYPDEKSSAPKEGAQLQR---- 137

Query: 142 TTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVER 201
             KS+ S                   PVPVVLTRYAAQ LYAPLRTVEPV GI  V +  
Sbjct: 138 --KSVPSA------------------PVPVVLTRYAAQQLYAPLRTVEPVTGIHPVSLHL 177

Query: 202 SLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHP 261
            + + TL P+ P+  +PL  W + ++ V A+KL+N   + ITLDPR L G+FV+A FQH 
Sbjct: 178 PVSITTLYPSEPIAVSPLAGWGVQNYAVVALKLRNTVKRNITLDPRALQGKFVSATFQHR 237

Query: 262 YLGSQGNASDTTTLYLVTRG 281
           +LG  G   DTT LYLVT G
Sbjct: 238 WLGEAGTPEDTTVLYLVTTG 257
>cro:ROD_33501 hypothetical protein
          Length = 262

 Score =  228 bits (581), Expect = 4e-58
 Identities = 130/285 (45%), Positives = 176/285 (61%), Gaps = 34/285 (11%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           LL++LV       AVE+++WER+PL + L I QERIVFVD+NVRVG   +L  KLR+QS+
Sbjct: 6   LLILLVALP--LHAVELMKWERIPLPVALNIGQERIVFVDRNVRVGYLAALEGKLRIQSS 63

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYG 131
            G +YL A      TRLQLQ+ + GE+IL+D++A++    +   EP++IV          
Sbjct: 64  NGTLYLLASQPFAATRLQLQDTENGELILLDVSASKG---EHIREPMRIV---------- 110

Query: 132 GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKR--ETPVPVVLTRYAAQMLYAPLRTVE 189
                R  K TT            D +P+ V      TP+PV LTRYAAQMLYAPLRTVE
Sbjct: 111 -----REEKKTT------------DAKPDAVPDPLPSTPLPVALTRYAAQMLYAPLRTVE 153

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
           P+ G+    V  +  + TLLP LPV + P+G WRLD + + A++LQN++A R+ LDPR+L
Sbjct: 154 PLPGVQPEGVRLAKTITTLLPALPVNAIPIGGWRLDPYHLAAIRLQNKSATRMELDPRQL 213

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAP 294
            G F  ++FQH +LG  G+A DTT LYL+TR H   QA +   AP
Sbjct: 214 HGWFYASSFQHRWLGPAGSAEDTTVLYLITRNHRPEQAILPEPAP 258
>hit:NTHI0131 hypothetical protein
          Length = 289

 Score =  224 bits (572), Expect = 4e-57
 Identities = 131/284 (46%), Positives = 169/284 (59%), Gaps = 28/284 (9%)

Query: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60
           M+ L +L  +A +     +   ASA  +++W R PL I L+I +ERI+FVD+NV+VG P 
Sbjct: 1   MKKLTLLLSAAFIF----SPMTASADVLMKWARKPLPIDLQIEKERILFVDKNVKVGYPP 56

Query: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120
            L  KLR+QSTGGA+YL A      TRLQL +  TGEIIL+D+ A  +  +  A EP++ 
Sbjct: 57  ELDSKLRIQSTGGAVYLKATADFPKTRLQLMDVATGEIILLDVQAKHSVAN--ASEPIRF 114

Query: 121 V---EGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYA 177
           V   + E  +  YG  A A +                   EP    +   P P  LTRYA
Sbjct: 115 VYENKVEKQTTAYGQDANAYN-------------------EPMPNARPALPAPAALTRYA 155

Query: 178 AQMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQ 237
           AQM YAPLR+VEP++G+ QV       L TLLP LPV++TPL +W+LD++ VTAV+LQNQ
Sbjct: 156 AQMFYAPLRSVEPLEGVRQVSHRLPTPLKTLLPALPVRATPLLSWQLDEYVVTAVRLQNQ 215

Query: 238 TAQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRG 281
              RI LDPREL G F  A FQH +LG      DTTTLYLVT G
Sbjct: 216 GQSRIDLDPRELQGRFYAATFQHNWLGGHDTPEDTTTLYLVTEG 259
>eic:NT01EI_0344 hypothetical protein
          Length = 309

 Score =  224 bits (572), Expect = 4e-57
 Identities = 137/301 (45%), Positives = 185/301 (61%), Gaps = 15/301 (4%)

Query: 10  SALLMVLVG-TTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRV 68
           S LL+ LV   ++ A A E ++WER+PL IPL++  ER+VFVD+NVRVG P +L  KLRV
Sbjct: 15  SLLLLPLVSLVSEPAQADEFMKWERIPLQIPLQVGLERVVFVDKNVRVGFPPALNGKLRV 74

Query: 69  QSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSS 127
           QSTGGA+YL A      TR+QLQ+ ++GE+IL+D+ A E    +   EPV++V  GE ++
Sbjct: 75  QSTGGAVYLKADSTFPQTRVQLQDVESGEVILLDVTAGE----KGPSEPVRLVYSGEVNT 130

Query: 128 ARYGGAATARSAKATTKSMDSTSRSNDEDDEPE-EVVKRETPVPVVLTRYAAQMLYAPLR 186
                ++T  + +    S  S    +D   + + + V    P+PV+LTRYAAQ LYAPLR
Sbjct: 131 V----SSTTDTRRQAENSDSSIQPGSDVGTQAKRKKVSYGAPIPVLLTRYAAQSLYAPLR 186

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
           TVE V GI  V       L TL P+  + +TPL AW + +  V AV+LQN  + RI LDP
Sbjct: 187 TVEAVPGIRPVNPHLPKRLTTLYPSEAITATPLAAWGVANRVVVAVRLQNTASLRIVLDP 246

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFSAAPADPR-ATRGAKH 305
           R L G+FV A FQH +LG  G   DTTT+Y+VT   G+   + F A P+  R A R AK 
Sbjct: 247 RALQGQFVAATFQHRWLGPVGTPEDTTTVYIVT---GMRPESAFIAEPSVVRKAVRTAKK 303

Query: 306 E 306
           E
Sbjct: 304 E 304
>eca:ECA0569 hypothetical protein
          Length = 308

 Score =  224 bits (570), Expect = 7e-57
 Identities = 124/273 (45%), Positives = 175/273 (64%), Gaps = 17/273 (6%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           LL  L+  +  A+A E+++WER+PL IPL++ QER++F D+NVRVG P +L DKLRVQST
Sbjct: 16  LLAFLMTVSWHAAADELIKWERIPLQIPLKVGQERVIFADKNVRVGFPPALNDKLRVQST 75

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYG 131
           GGA+YL A  A   TRLQLQ+ ++GEIIL+D+ A+   ++ P  EP+++V        Y 
Sbjct: 76  GGAVYLKADSAFPQTRLQLQDLESGEIILLDVTAS---LNGPT-EPIRLV--------YS 123

Query: 132 GAATA-----RSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLR 186
           G  T      R AK++ +S  S++     D +  +  +   P+PVVLTR+AAQ LY PLR
Sbjct: 124 GDVTTVDNSDRPAKSSERSSSSSASETKLDAKAPKTPRYNAPLPVVLTRFAAQTLYGPLR 183

Query: 187 TVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDP 246
            VEPV GI  V    S  + TL P+ P   T L AW +    V A++++N +++++ LDP
Sbjct: 184 AVEPVSGIHPVNPRISGKITTLYPSEPFDITTLSAWGVGARSVVALRIRNTSSRKVVLDP 243

Query: 247 RELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           R L G+FV+A FQH ++G  G   DTTTLYLVT
Sbjct: 244 RILQGQFVSATFQHRWVGPIGTPEDTTTLYLVT 276
>hso:HS_1761 hypothetical protein
          Length = 306

 Score =  222 bits (565), Expect = 3e-56
 Identities = 125/262 (47%), Positives = 164/262 (62%), Gaps = 25/262 (9%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A A  +++W+RLPL I L++ +ER++ VD+NV+VG P++L  K+R+QSTGGA+YL A + 
Sbjct: 21  AQAELLMKWQRLPLPIDLQVEKERVILVDKNVKVGYPKALEGKIRLQSTGGAVYLKALEP 80

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
               RLQL++  T EIIL+DI A E  +D P          ET    Y G          
Sbjct: 81  FPTARLQLKDMLTNEIILLDITAKEK-VDNPQ---------ETVRLLYEG---------- 120

Query: 143 TKSMDSTSRSNDEDDEPEEVVKR---ETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKV 199
              +++ S S ++D+E  E V     + PVP  LTRYAAQMLYAPLRTVEPV GI Q+  
Sbjct: 121 --KLENQSGSLNQDEEVTEEVASASVQLPVPAALTRYAAQMLYAPLRTVEPVLGIRQIAH 178

Query: 200 ERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQ 259
                + TLLP  P+ +TPL +W+L D+ VTA++LQNQ   RITLDPREL G F  A FQ
Sbjct: 179 GLPSKITTLLPAYPITATPLMSWQLGDYVVTAIRLQNQGTSRITLDPRELQGRFYAATFQ 238

Query: 260 HPYLGSQGNASDTTTLYLVTRG 281
           H +L   G+  DTTTLYLVT G
Sbjct: 239 HHWLSGLGSTEDTTTLYLVTEG 260
>hdu:HD0936 hypothetical protein
          Length = 286

 Score =  221 bits (564), Expect = 3e-56
 Identities = 124/283 (43%), Positives = 176/283 (62%), Gaps = 26/283 (9%)

Query: 1   MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR 60
           M+ + +  G++LL+     + +ASA  +L+W+R PL I L++ +ERIVF D+NV+VG P 
Sbjct: 1   MKKMILFVGASLLL-----SNVASAEILLKWDRKPLPIELQVKEERIVFADKNVKVGYPA 55

Query: 61  SLTDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKI 120
            L  KLR+QS+GGA+Y  A      +RLQL +  TGE+IL+D+ A   P    A EP+++
Sbjct: 56  QLEGKLRMQSSGGAVYFTALAEFPKSRLQLVDLATGELILLDVEAK--PHIPNANEPIRL 113

Query: 121 VEGETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPE-EVVKRETPVPVVLTRYAAQ 179
           V  +    +                  ST  + D  +E + + VK + PVP  LTRYAAQ
Sbjct: 114 VYTDKVEKQ------------------STVFNQDSGEEADLKNVKPQLPVPAALTRYAAQ 155

Query: 180 MLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTA 239
           M YAPLRTVEP++G+ QV       + TLLP  P+++TPL +W+L++F VTA++LQN+ +
Sbjct: 156 MFYAPLRTVEPLEGVRQVAHRLPNKITTLLPAYPIQATPLLSWQLENFVVTAIRLQNRGS 215

Query: 240 QRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGH 282
             I LDPREL G F  A FQH +LG  G+  DTTTLYLVT G+
Sbjct: 216 SHIELDPRELQGRFYAATFQHGWLGGHGSPEDTTTLYLVTEGY 258
>xbo:XBJ1_3396 conserved hypothetical protein; putative exported protein
          Length = 278

 Score =  221 bits (563), Expect = 5e-56
 Identities = 124/260 (47%), Positives = 159/260 (61%), Gaps = 29/260 (11%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A A E+++WER+PL+I L++ QERI+F D+NVRVGL  SL+DKLRVQS GGAIYL A  +
Sbjct: 26  AKADELMKWERIPLSIALKVGQERIIFADRNVRVGLSPSLSDKLRVQSAGGAIYLKASQS 85

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV-EGETSSARYGGAATARSAKA 141
              TRLQLQ+++ GEIIL+DI AT+        EPV+I+   E +S    GA   R +  
Sbjct: 86  FPSTRLQLQDSENGEIILLDITATKTG----PTEPVRILYPDEKNSVPKEGAPHQRKSAP 141

Query: 142 TTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVER 201
                                     P PV+LTRYAAQ LYAPLRTVEPV GI  V +  
Sbjct: 142 LA------------------------PAPVILTRYAAQQLYAPLRTVEPVTGIHPVSLHL 177

Query: 202 SLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHP 261
              + T+ P+ P+  +PL  W + ++ V A+KL+N   + ITLDPR L G+FV A FQH 
Sbjct: 178 PAAITTVYPSEPIAVSPLAGWGMQNYTVVALKLRNTAKRNITLDPRALQGQFVAATFQHR 237

Query: 262 YLGSQGNASDTTTLYLVTRG 281
           +LG  G   DTT LYLVTRG
Sbjct: 238 WLGEAGTPEDTTVLYLVTRG 257
>hsm:HSM_1701 hypothetical protein
          Length = 294

 Score =  219 bits (557), Expect = 2e-55
 Identities = 116/271 (42%), Positives = 167/271 (61%), Gaps = 18/271 (6%)

Query: 12  LLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQST 71
           L+ +L+G +  + A  +++WER PL + L++ +ERI+FVD+NV+VG P  L  KLR+QST
Sbjct: 8   LVSLLIGFSGSSLADVLMKWERKPLPVALQVEKERIIFVDKNVKVGYPAELDGKLRIQST 67

Query: 72  GGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYG 131
           GGA+YL A +    TR++ ++  TGEI L D+ A     +    E +++V   T      
Sbjct: 68  GGAVYLKALETFPSTRIEFRDVTTGEIFLFDLTAASKVANPE--EAIRVVFDGT------ 119

Query: 132 GAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPV 191
                       K   S++R ++  D P    + + PVP  LTRYAAQ LYAPLRTVEP+
Sbjct: 120 ----------VEKQSFSSNRDDESSDLPIANSRPQLPVPAALTRYAAQSLYAPLRTVEPL 169

Query: 192 DGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMG 251
           DG+ +V       +  LLP   +++TPL +W+LD++ VTA++LQN+   +ITLDPREL G
Sbjct: 170 DGVRRVAHRLPKKITKLLPAYSIEATPLISWQLDEYVVTAIRLQNKGNTQITLDPRELQG 229

Query: 252 EFVTAAFQHPYLGSQGNASDTTTLYLVTRGH 282
           +F  A FQH +LG  G   DTTTLYLVT G+
Sbjct: 230 QFYAATFQHNWLGGYGENEDTTTLYLVTEGY 260
>ecq:ECED1_3565 conserved hypothetical protein; putative exported protein
          Length = 302

 Score =  213 bits (541), Expect = 2e-53
 Identities = 119/284 (41%), Positives = 176/284 (61%), Gaps = 15/284 (5%)

Query: 3   ILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSL 62
           +  +L  + ++M L   +  A A E+++WER+PL I L++ QER++F D+NVRVG P +L
Sbjct: 6   VCSLLRPAVMMMSLSVLSLTAQADELMKWERIPLNILLKVGQERVIFADKNVRVGFPPAL 65

Query: 63  TDKLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIV- 121
             KLRVQSTGGA+YL A  A   TR+QLQ+ ++GE+IL+D+ A E    +   EPV+IV 
Sbjct: 66  NGKLRVQSTGGAVYLKADSAFPQTRVQLQDVESGEMILLDVTAGE----KGTTEPVRIVY 121

Query: 122 EGETSSARYGGAATARSAKATTKS----MDSTSRSNDEDDEPEEVVKRETPVPVVLTRYA 177
           +G+ S+      +  ++ K+ + +    MD+ +++   +    E++      PV+LTRYA
Sbjct: 122 DGDVSTVSRAAGSDVQTVKSRSSNGKAGMDNGTQARRTEPRYAELL------PVLLTRYA 175

Query: 178 AQMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQ 237
           AQ LYAPLRT+EPV GI  V       + T+ P+ P+  +P+ AW      V A+KL + 
Sbjct: 176 AQSLYAPLRTLEPVAGIRPVVPHLPRQITTVYPSEPLTVSPVAAWAAGGRTVVALKLTST 235

Query: 238 TAQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRG 281
            ++RI LDPR L G FV A FQH +LG+ G   DTT LY+VT G
Sbjct: 236 VSRRIVLDPRALQGRFVAATFQHRWLGAAGTPEDTTMLYVVTAG 279
>kpu:KP1_0617 hypothetical protein
          Length = 276

 Score =  200 bits (509), Expect = 8e-50
 Identities = 110/259 (42%), Positives = 153/259 (59%), Gaps = 29/259 (11%)

Query: 23  ASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDA 82
           A A E+++WE +PL + L + QERIV V + VR+G P +L  K+R+QS GG ++L A   
Sbjct: 35  AFATEVVQWENIPLPVTLHVGQERIVDVGKAVRIGYPATLEGKVRLQSAGGKVFLLANTT 94

Query: 83  IEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKAT 142
              TR+QL++  +GE+IL+DI AT++     A++                 + A    AT
Sbjct: 95  FPATRIQLRDTSSGELILLDIQATQSTSPLEAMQ----------------ISYAPQTPAT 138

Query: 143 TKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERS 202
            K+             P  V     P+PV+L RYAAQ LYAPLRTVE + G+    V  +
Sbjct: 139 AKT-------------PVPVTASTEPLPVLLVRYAAQNLYAPLRTVEALPGVTPAPVRLA 185

Query: 203 LDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPY 262
             + TLLP  PV + PL +W+++   VTA++LQN++ QRITLDPREL G+F  AAFQH +
Sbjct: 186 KRITTLLPQQPVTAIPLASWQVNATTVTAIRLQNRSGQRITLDPRELQGQFTAAAFQHYW 245

Query: 263 LGSQGNASDTTTLYLVTRG 281
           LG +G A DTT  YLVT G
Sbjct: 246 LGPRGLAEDTTVAYLVTEG 264
>noc:Noc_0645 hypothetical protein
          Length = 274

 Score =  148 bits (373), Expect = 5e-34
 Identities = 98/272 (36%), Positives = 146/272 (53%), Gaps = 32/272 (11%)

Query: 12  LLMVLVGTTQIASAV----EILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLR 67
           L   LV   Q+  A     E + W + P+AIPL +++ER+V    +V +GLP+SLT  LR
Sbjct: 23  LCFPLVSFAQVDDAASNSPERIVWNKAPIAIPLVVSEERLVHFPDSVSIGLPQSLTPFLR 82

Query: 68  VQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSS 127
            QS  G +YL A+   E TR+ +++   G I ++DI+A+ +  D  +L  V+I+     S
Sbjct: 83  SQSINGTLYLLARQPFETTRVMVRSETDGPIYVLDISASPSGSDSRSLPDVRIL---LES 139

Query: 128 ARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRT 187
            +  GAA + S        D+ S S                    LTRYAAQ LYAP R 
Sbjct: 140 PQDAGAAESTS--------DNRSLSLGY---------------ATLTRYAAQQLYAPTRL 176

Query: 188 VEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPR 247
           +    G+  + V  + +   L+    V++ P+ AW++   +VTAVKL N+T + + LDPR
Sbjct: 177 IPHQSGVVAMPV--NAEPVDLVHGAKVEAVPVAAWKVGLKYVTAVKLTNRTQRPLVLDPR 234

Query: 248 ELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           EL G ++ A FQH  L   GNA+DTT +YLV+
Sbjct: 235 ELRGSWLAATFQHNRLLPAGNAADTTAVYLVS 266
>aav:Aave_2758 hypothetical protein
          Length = 255

 Score =  100 bits (248), Expect = 2e-19
 Identities = 81/268 (30%), Positives = 127/268 (47%), Gaps = 32/268 (11%)

Query: 16  LVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAI 75
           L GT   ++  E   + R P+ + L + QER+V +  +  + +P  +    RV+S GG +
Sbjct: 6   LTGTA--SAPAERAVFAREPVRVNLTVGQERLVTLPADALLHVPSDIEAVARVESIGGTL 63

Query: 76  YLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALE---PVKIVEGETSS--ARY 130
           Y+ A     P R+  +   +G+ I +D+ A + P    A      V +VE  T +     
Sbjct: 64  YVTALVPFTPIRIVAELVDSGQQIPLDLVANK-PSGAGAAGGELQVSVVEPGTVAQPTAV 122

Query: 131 GGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEP 190
            G AT   A A                 PE  +       V LTRYAA+ LYAP R   P
Sbjct: 123 DGVATGPRAAAG----------------PEVDM-------VQLTRYAARQLYAPRRLASP 159

Query: 191 VDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELM 250
           + G++QV V    +LA L+    V++ P+G WR     VTAV++ N++   + +    L 
Sbjct: 160 IAGVSQVAVTGD-ELAGLVRGAAVQAVPVGQWRAGGLTVTAVRISNRSRFPLEVPLESLR 218

Query: 251 GEFVTAAFQHPYLGSQGNASDTTTLYLV 278
           G ++ A  QH  +G  G+ +DTT +YLV
Sbjct: 219 GRWLAATAQHGRIGPAGSDTDTTAIYLV 246
>lpp:lpp2389 hypothetical protein
          Length = 260

 Score = 99.8 bits (247), Expect = 2e-19
 Identities = 72/272 (26%), Positives = 137/272 (50%), Gaps = 39/272 (14%)

Query: 12  LLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRV--GLPRSLTDKLR 67
           L ++ + ++Q A A+  E + W++ P+ + L +N+ER++   Q + +      S T  L+
Sbjct: 8   LTIIALISSQYALALDAEHVLWDKTPIPVELSLNEERLIHFPQAISIVDNEAASQTALLK 67

Query: 68  VQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSS 127
           +Q    A+YL  KD  +  RL +Q    GE+I+++++  +   D   ++P++++      
Sbjct: 68  IQD---ALYLKGKDVFKNKRLLVQLMPQGEVIILNLSVNDKTHD---VKPIEVL------ 115

Query: 128 ARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRT 187
                                   S +  + P+EVV       V LTR+A Q LYAP R 
Sbjct: 116 ----------------------LESKENTNSPQEVVNPLDLNAVTLTRFAIQSLYAPQRL 153

Query: 188 VEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPR 247
           +   DG+ +V ++    + +L     +++ PL +W    F+VTAV+L+N   + + +DPR
Sbjct: 154 LVIPDGVGRVPMQTRKQV-SLFYGASIEARPLISWHGGAFYVTAVELKNLLNKEVIVDPR 212

Query: 248 ELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           ++MG + TA F      S  +  ++TT++LV+
Sbjct: 213 QMMGNWQTATFYPTNTLSPRSNKESTTVFLVS 244
>lpc:LPC_1871 hypothetical protein
          Length = 260

 Score = 99.4 bits (246), Expect = 3e-19
 Identities = 72/272 (26%), Positives = 137/272 (50%), Gaps = 39/272 (14%)

Query: 12  LLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRV--GLPRSLTDKLR 67
           L ++ + ++Q A A+  E + W++ P+ + L +N+ER++   Q + +      S T  L+
Sbjct: 8   LTIIALISSQYALALDAEHVLWDKTPIPVELSLNEERLIHFPQAISIVDNEAASQTALLK 67

Query: 68  VQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSS 127
           +Q    A+YL  KD  +  RL +Q    GE+I+++++  +   D   ++P++++      
Sbjct: 68  IQD---ALYLKGKDVFKNKRLLVQLMPQGEVIILNLSVNDKTHD---VKPIEVL------ 115

Query: 128 ARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRT 187
                                   S +  + P+EVV       V LTR+A Q LYAP R 
Sbjct: 116 ----------------------LESKENTNSPQEVVNPLDLNAVTLTRFAIQSLYAPQRL 153

Query: 188 VEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPR 247
           +   DG+ +V ++    + +L     +++ PL +W    F+VTAV+L+N   + + +DPR
Sbjct: 154 LVIPDGVGRVPMQTRKQV-SLFYGASIEARPLISWHGGAFYVTAVELKNLLNKEVIVDPR 212

Query: 248 ELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           ++MG + TA F      S  +  ++TT++LV+
Sbjct: 213 QMMGNWQTATFYPTNTLSLRSNKESTTVFLVS 244
>maq:Maqu_3929 hypothetical protein
          Length = 282

 Score = 97.4 bits (241), Expect = 1e-18
 Identities = 77/278 (27%), Positives = 131/278 (47%), Gaps = 32/278 (11%)

Query: 6   VLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDK 65
           ++T  A L V   +     A +I+ ++ LP+ I L   +ER +    +V+VG+ +    K
Sbjct: 5   IITSVAFLCVATSSW----AEQIIHYDNLPVTIELHNGEERSIQFGSHVQVGITKGQQVK 60

Query: 66  --LRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEG 123
              R QS  GA++    +A +  R+Q++    G++IL+D+ AT+    + +LE V+IV  
Sbjct: 61  KLFRAQSAQGAVHFLPYEAFDKQRVQIRRMDDGKVILLDLIATDKADGEKSLEDVRIV-- 118

Query: 124 ETSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYA 183
                          A     S D  + S  E        K E   P+ LTRYAAQ LY 
Sbjct: 119 --------------LASDNVVSSDDAAASMPE--------KVELITPIDLTRYAAQRLYG 156

Query: 184 PLRTVEPVDGIAQ--VKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQR 241
           P R      GI++  + V+ ++ +          S P+ A++   +++ A+ ++N + + 
Sbjct: 157 PTRLHHDQAGISETPLAVKGAVRIFKGPARYKTLSKPVVAYQGGGYYLAALYIRNVSDET 216

Query: 242 ITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           + LD  +L   F  A  QH  L  QG   D+T LYL++
Sbjct: 217 VQLDYLDLNLPFSHATLQHHSLEPQGTPGDSTVLYLIS 254
>lpc:LPC_2287 hypothetical protein
          Length = 258

 Score = 94.0 bits (232), Expect = 1e-17
 Identities = 79/275 (28%), Positives = 135/275 (49%), Gaps = 37/275 (13%)

Query: 7   LTGSALLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTD 64
           LT   LL++    TQ++ A+  E L WE++PL I L IN+ER+V   Q +++ + + L+ 
Sbjct: 3   LTKHILLILGFMLTQVSYALQSEHLVWEKVPLTIELPINKERLVQFPQAIKI-IDQQLST 61

Query: 65  KLRVQSTGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGE 124
            L +    G++YL AKD     RL +Q    GE+I++++ A E  ++     P++I+  +
Sbjct: 62  NLDILKVKGSLYLNAKDTFNDARLIVQLLPEGEVIILNLKANEKVVN---TTPIEILIDD 118

Query: 125 TSSARYGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAP 184
                          KAT +S  S    N                 + LTR+A Q LY+P
Sbjct: 119 --------------PKATHQSGASQYEYN----------------AIQLTRFAIQALYSP 148

Query: 185 LRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITL 244
            R  +  +GI +  ++ +  +  L     +++ PL +WR    +VT V L+N   Q + L
Sbjct: 149 ERVRDIPEGIYRSPMQTNKTI-PLFYGASIEAHPLASWRGGSLYVTVVDLKNLLNQPVKL 207

Query: 245 DPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
              +LMG + TA+F         N  ++TT++LV+
Sbjct: 208 QFSKLMGRWQTASFYPKGELPPRNQHESTTVFLVS 242
>lpp:lpp1063 hypothetical protein
          Length = 258

 Score = 92.4 bits (228), Expect = 3e-17
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 37/270 (13%)

Query: 12  LLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQ 69
           LL++    TQ++ A+  E L WE++PL I L IN+ER+V   Q +++ + + L+  L + 
Sbjct: 8   LLIIGFMLTQVSYALQSEHLVWEKVPLTIELPINKERLVQFPQAIKI-IDQQLSTNLDIL 66

Query: 70  STGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSAR 129
              G++YL AKD     RL +Q    GE++++++ A E  ++     P++I+  +     
Sbjct: 67  KVKGSLYLKAKDTFNDARLIVQLLPEGEVLILNLKANEKAVN---TTPIEILIDD----- 118

Query: 130 YGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVE 189
                     K T +S  S    N                 + LTR+A Q LY+P R  +
Sbjct: 119 ---------PKVTHQSSASQYEYN----------------AIQLTRFAIQALYSPERVRD 153

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
             +GI +  ++ +  +  L     +++ PL +WR    +VTAV L+N   Q + L   +L
Sbjct: 154 IPEGIYRSPMQTNKTI-PLFYGASIEAHPLASWRGGSLYVTAVDLKNLLNQPVKLQFSKL 212

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           MG + TA+F         N  ++TT+++V+
Sbjct: 213 MGHWQTASFYPKSELPPRNQHESTTVFVVS 242
>lpn:lpg0992 hypothetical protein
          Length = 278

 Score = 92.4 bits (228), Expect = 3e-17
 Identities = 76/270 (28%), Positives = 132/270 (48%), Gaps = 37/270 (13%)

Query: 12  LLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQ 69
           LL++    TQ++ A+  E L WE++PL I L IN+ER+V   Q +++ + + L+  L + 
Sbjct: 28  LLIIGFMLTQVSYALQSEHLVWEKVPLTIELPINKERLVQFPQAIKI-IDQQLSTNLDIL 86

Query: 70  STGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSAR 129
              G++YL AKD     RL  Q    GE+I++++ A E  ++     P++I+  +     
Sbjct: 87  KVKGSLYLKAKDTFNDARLIAQLLPEGEVIILNLKANEKAVN---TTPIEILIDD----- 138

Query: 130 YGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVE 189
                     K T +S  S    N                 + LTR+A Q LY+P R  +
Sbjct: 139 ---------PKVTHQSSASQYEYN----------------AIQLTRFAIQALYSPERVRD 173

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
             +GI +  ++ +  +  L     +++ PL +WR    +VTAV L+N   Q + L   +L
Sbjct: 174 IPEGIYRSPMQTNKTI-PLFYGASIEAHPLASWRGGSLYVTAVDLKNLLNQPVKLQFSKL 232

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           MG + TA+F         N  ++TT+++V+
Sbjct: 233 MGHWQTASFYPKSELPPRNQHESTTVFVVS 262
>eba:ebA410 hypothetical protein
          Length = 362

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 75/251 (29%), Positives = 110/251 (43%), Gaps = 34/251 (13%)

Query: 31  WERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQSTGGAIYLFAKDAIEPTRLQL 90
           +ERLP+ + L  + ER+V       + LP  L   L VQ      YL A       R+ +
Sbjct: 133 FERLPVHVLLAPDAERLVHFPFVALMDLPPGLEGLLEVQIIEDTAYLTANAPFPRARVHV 192

Query: 91  QNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAKATTKSMDSTS 150
           Q       I +DI A E     P L+ V +  G                           
Sbjct: 193 QAIDGTAKIPLDIEAAEGVAVAPMLQ-VHLPSG--------------------------- 224

Query: 151 RSNDEDDEPEEVVKRETPV--PVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERSLDLATL 208
              D+ D+      RE P    + LTRYAA+ LYAP R V  + G+ Q  V+R   +  L
Sbjct: 225 ---DDADDVASTGSREAPTVDMIELTRYAAKTLYAPSRLVPVLPGVQQEPVDRK-TVPGL 280

Query: 209 LPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPYLGSQGN 268
                V++ PLGAW      VTAV+  N++ + + LD  +L G ++ A  QH  L  +G+
Sbjct: 281 YRGAEVETAPLGAWSSGSLHVTAVRFTNRSDRPLELDIEQLRGRWIAATPQHWRLLPRGS 340

Query: 269 ASDTTTLYLVT 279
            +DTT +YL++
Sbjct: 341 EADTTAVYLIS 351
>lpf:lpl1025 hypothetical protein
          Length = 258

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 71/270 (26%), Positives = 128/270 (47%), Gaps = 37/270 (13%)

Query: 12  LLMVLVGTTQIASAV--EILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQ 69
           LL++    TQ++ A+  E L WE++PL I L IN+ER+V   Q +++ + + L+  L + 
Sbjct: 8   LLIIGFMLTQVSYALQSEHLVWEKVPLTIELPINKERLVQFPQAIKI-IDQQLSTNLDIL 66

Query: 70  STGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSAR 129
              G++YL AKD     RL +Q    GE++++++ A E   +     P++I+     +  
Sbjct: 67  KVKGSLYLKAKDTFNDARLIVQLLPEGEVLILNLKANEKAAN---TTPIEILIDNPKTTH 123

Query: 130 YGGAATARSAKATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVE 189
             GA+                                    + LTR+A Q LY+P R   
Sbjct: 124 QSGASQYEYN------------------------------AIQLTRFAIQALYSPERVRN 153

Query: 190 PVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPREL 249
             +GI +  ++ +  +  L     +++ PL +WR    +VTA+ L+N   Q + L   +L
Sbjct: 154 IPEGIYRSPMQTNKTI-PLFYGASIEAHPLASWRGGSLYVTAIDLKNLLNQPVKLQFSKL 212

Query: 250 MGEFVTAAFQHPYLGSQGNASDTTTLYLVT 279
           MG + TA+F         N  ++TT+++V+
Sbjct: 213 MGHWQTASFYPKSELPPRNQHESTTVFVVS 242
  Database: genes
    Posted date:  May 6, 2010  8:55 AM
  Number of letters in database: 1,916,570,134
  Number of sequences in database:  5,338,631
  
Lambda     K      H
   0.316    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,040,570,776
Number of Sequences: 5338631
Number of extensions: 40824045
Number of successful extensions: 142452
Number of sequences better than 1.0e-05: 75
Number of HSP's better than  0.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 142292
Number of HSP's gapped (non-prelim): 85
length of query: 307
length of database: 1,916,570,134
effective HSP length: 132
effective length of query: 175
effective length of database: 1,211,870,842
effective search space: 212077397350
effective search space used: 212077397350
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 129 (54.3 bits)