BLASTP 2.2.11 [Jun-05-2005]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BQ10550 |Bartonella quintana Toulouse|virB4 protein
homolog
         (784 letters)

Database: genes 
           1,720,133 sequences; 614,153,286 total letters

Searching..................................................done


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

bqu:BQ10550  virB4; virB4 protein homolog; K03199 type IV se...  1560   0.0  
bhe:BH13280  virB4; VirB4 protein homolog; K03199 type IV se...  1494   0.0  
mes:Meso_4346  type IV secretion/conjugal transfer ATPase, V...  1011   0.0  
atc:AGR_pAT_223  virB4; virB4 type IV secretion protein; K03...  1009   0.0  
sme:SMa1315  virB4; VirB4 type IV secretion protein; K03199 ...  1006   0.0  
atu:Atu5165  avhB4; agrobacterium virulence homologue virB4;...   977   0.0  
xfa:XFa0007  type IV secretion system protein VirB4; K03199 ...   660   0.0  
bqu:BQ12580  trwK; trwK protein; K03199 type IV secretion sy...   583   e-165
ret:RHE_PA00045  virB4a; transport secretion system IV, VirB...   574   e-162
atc:AGR_pTi_8  virB4; VIRB4 protein precursor; K03199 type I...   570   e-161
atu:Atu6170  virB4; component of type IV secretion system; K...   570   e-161
bhe:BH15660  trwK; TrwK protein; K03199 type IV secretion sy...   569   e-160
bxe:Bxe_C0450  putative type IV secretion system protein Vir...   553   e-156
bch:Bcen2424_3315  type IV secretion/conjugal transfer ATPas...   542   e-152
bcn:Bcen_4851  type IV secretion/conjugal transfer ATPase, V...   542   e-152
bxe:Bxe_A1756  putative type IV secretion system protein Vir...   542   e-152
bxe:Bxe_A2655  putative type IV secretion system protein Vir...   542   e-152
rfe:RF_0088  virB4_1; type IV secretion/conjugal transfer AT...   526   e-147
rpr:RP103  virB4; virB4 protein precursor; K03199 type IV se...   525   e-147
bms:BRA0066  virB4; type IV secretion system protein VirB4; ...   525   e-147
bme:BMEII0028  ATPase virB4 homolog; K03199 type IV secretio...   524   e-147
bmb:BruAb2_0066  virB4; type IV secretion system protein Vir...   523   e-147
bmf:BAB2_0065  shikimate kinase:ATP/GTP-binding site motif A...   523   e-147
ccr:CC2419  type IV secretion system protein B4, putative; K...   522   e-146
rty:RT0033  virB4a; VirB4 protein precursor; K03199 type IV ...   522   e-146
rco:RC0141  virB4; virB4 protein precursor; K03199 type IV s...   519   e-145
rbe:RBE_1266  virB4-1; VirB4; K03199 type IV secretion syste...   518   e-145
xcb:XC_1639  VirB4 protein; K03199 type IV secretion system ...   513   e-144
xcc:XCC2474  virB4; VirB4 protein; K03199 type IV secretion ...   513   e-144
xac:XAC2614  virB4; VirB4 protein; K03199 type IV secretion ...   511   e-143
nha:Nham_4445  type IV secretion/conjugal transfer ATPase, V...   504   e-141
aph:APH_0373  virB4-1; type IV secretion system protein VirB4     500   e-140
ech:ECH_0495  virB4-1; type IV secretion system protein VirB4     497   e-139
ecn:Ecaj_0533  CagE, TrbE, VirB family component of typeIV t...   497   e-139
mlo:mlr9251  conjugal transfer protein; K03199 type IV secre...   494   e-138
ama:AM814  virB4; VirB4 protein; K03199 type IV secretion sy...   493   e-138
bpe:BP3790  putative bacterial secretion system protein; K03...   490   e-137
bpa:BPP4311  putative bacterial secretion system protein; K0...   490   e-137
vfi:VFB39  VirB4 ATPase; K03199 type IV secretion system pro...   490   e-137
bbr:BB4897  putative bacterial secretion system protein; K03...   489   e-137
eli:ELI_03225  type IV secretion system protein B4, putative      489   e-136
erg:ERGA_CDS_05400  virB4; VIRB4 protein precursor; K03199 t...   486   e-136
erw:ERWE_CDS_05510  virB4; VIRB4 protein precursor; K03199 t...   486   e-136
eru:Erum5250  virB4; type IV secretion system protein VirB4;...   486   e-136
net:Neut_2636  type IV secretion/conjugal transfer ATPase, V...   485   e-135
wbm:Wbm0797  type IV secretory pathway, VirB4 components; K0...   481   e-134
wol:WD0858  virB4; type IV secretion system protein VirB4; K...   476   e-132
nse:NSE_0863  virB4-2; type IV secretion system protein VirB4     462   e-128
mes:Meso_4177  type IV secretion/conjugal transfer ATPase, V...   451   e-125
yps:pYptb0006  triC; TriC protein; K03199 type IV secretion ...   390   e-107
ypm:YP_pCRY09  virB4; type IV secretory pathway VirB4 compon...   384   e-105
eca:ECA1620  virB4; putative conjugal transfer protein; K031...   374   e-102
lpf:lpl0153  lvhB4; Legionella vir homologue protein; K03199...   354   5e-96
lpn:lpg1254  virB4; LvhB4; K03199 type IV secretion system p...   347   8e-94
lpp:lpp0171  lvhB4; legionella vir homologue protein; K03199...   345   2e-93
xcv:XCVc0041  virB4; type IV secretion system protein VirB4;...   303   8e-81
xac:XACb0045  virB4; VirB4 protein; K03199 type IV secretion...   301   3e-80
rde:RD1_A0014  virB4; VirB4 protein, putative                     300   7e-80
sit:TM1040_3819  CagE, TrbE, VirB component of type IV trans...   279   2e-73
rle:pRL70152  putative crown gall-like type IV secretion sys...   278   4e-73
wol:WD1173  type IV secretion system protein VirB4, putative...   265   3e-69
hpj:jhp0492  cagE; DNA transfer protein (Agrobacterium VirB4...   248   3e-64
hpy:HP0544  cag23; cag pathogenicity island protein 23 (picb...   247   7e-64
wbm:Wbm0750  type IV secretory pathway, VirB4 components; K0...   239   2e-61
ama:AM1053  virB4; VirB4 protein; K03199 type IV secretion s...   215   4e-54
ecn:Ecaj_0839  CagE, TrbE, VirB family component of typeIV t...   214   8e-54
erw:ERWE_CDS_08440  virB4; VirB4 protein; K03199 type IV sec...   214   8e-54
eru:Erum7980  putative type IV secretion system protein; K03...   214   8e-54
erg:ERGA_CDS_08350  virB4; VirB4 protein; K03199 type IV sec...   213   2e-53
rfe:RF_1250  virB4_2; type IV secretion/conjugal transfer AT...   212   3e-53
ech:ECH_1041  virB4-2; type IV secretion system protein VirB4     206   2e-51
rco:RC1217  virB4; virB4 protein precursor; K03199 type IV s...   202   2e-50
rpa:RPA2230  trbE1; conjugal transfer protein trbE; K03199 t...   202   3e-50
rty:RT0771  virB4b; VirB4 protein precursor; K03199 type IV ...   201   4e-50
rbe:RBE_0080  virB4-2; VirB4; K03199 type IV secretion syste...   201   7e-50
mes:Meso_3854  ATPas                                              200   1e-49
rpr:RP784  virB4; virB4 protein precursor; K03199 type IV se...   199   2e-49
hpa:HPAG1_0519  cag pathogenicity island protein E                197   1e-48
rpc:RPC_3538  ATPase                                              193   1e-47
mes:Meso_0506  ATPas                                              192   2e-47
bam:Bamb_2007  AAA ATPase                                         192   3e-47
rme:Rmet_1344  ATPase                                             190   1e-46
mes:Meso_2321  ATPas                                              189   2e-46
rpa:RPA4121  trbE2; conjugal transfer protein trbE; K03199 t...   188   4e-46
mlo:mll9608  conjugal transfer protein trbE; K03199 type IV ...   187   9e-46
nar:Saro_0315  CagE, TrbE, VirB component of type IV transpo...   187   1e-45
pau:PA14_30910  trbE; TrbE-like protein                           186   1e-45
rpc:RPC_3898  ATPase                                              185   3e-45
rpe:RPE_4021  AAA ATPase                                          184   7e-45
mlo:mlr6400  conjugal transfer protein trbE; K03199 type IV ...   181   6e-44
sal:Sala_2611  hypothetical protein                               180   1e-43
rso:RSc2581  trbE, RS00789; probable conjugal transfer prote...   180   1e-43
bja:bll8285  trbE; probable conjugal transfer protein; K0319...   178   4e-43
pol:Bpro_5229  type IV secretory pathway VirB4 components-li...   178   4e-43
sal:Sala_2483  putative conjugal transfer protein                 177   9e-43
rme:Rmet_1553  ATPase                                             177   9e-43
psp:PSPPH_B0028  conjugal transfer protein; K03199 type IV s...   177   1e-42
aph:APH_0419  type IV secretion system protein VirB4, trunca...   172   2e-41
rle:pRL80139  trbE; putative conjugal transfer protein TrbE       171   8e-41
nha:Nham_4566  type IV secretion/conjugal transfer ATPase, V...   169   2e-40
ret:RHE_PA00175  trbE; conjugal transfer protein E; K03199 t...   167   7e-40
aph:APH_1129  virB4-2; type IV secretion system protein VirB4     160   1e-37
rme:Rmet_6305  type IV secretory pathway VirB4 components-li...   159   2e-37
bam:Bamb_6632  type IV secretion/conjugal transfer ATPase, V...   155   3e-36
reu:Reut_D6505  CagE, TrbE, VirB component of type IV transp...   155   3e-36
dps:DPPB14  trbE; probable conjugal transfer protein TrbE; K...   155   5e-36
eba:p2B4  trbE; TrbE protein of DNA transfer system; K03199 ...   155   5e-36
pol:Bpro_5465  type IV secretory pathway VirB4 components-like    152   3e-35
atc:AGR_pTi_83  conjugal transfer protein TrbE; K03199 type ...   152   4e-35
atu:Atu6038  trbE; conjugal transfer protein; K03199 type IV...   152   4e-35
net:Neut_2552  CagE, TrbE, VirB component of type IV transpo...   139   3e-31
rfr:Rfer_4260  type IV secretory pathway VirB4 components-li...   132   4e-29
ppr:PBPRB1600  hypothetical TrbE protein; K03199 type IV sec...   126   2e-27
hpa:HPAG1_0017  ATPase/DNA transfer protein                       123   2e-26
hpj:jhp0015  virB4_1; DNA transfer protein; K03199 type IV s...   122   3e-26
hpy:HP0459  virB4; virB4 homolog; K03199 type IV secretion s...   121   7e-26
hpy:HP0017  virB4; virB4 homolog; K03199 type IV secretion s...   121   7e-26
wsu:WS1099  virB4 homolog; K03199 type IV secretion system p...   118   5e-25
psp:PSPPH_A0145  conjugal transfer protein                        118   6e-25
hpy:HP0441  VirB4 homolog; K03199 type IV secretion system p...   115   5e-24
hac:Hac_1691  virB4; type IV secretory pathway component VirB4    112   5e-23
nwi:Nwi_2098  trbE; conjugal transfer protein TrbE; K03199 t...    98   7e-19
nse:NSE_0766  virB4-1; type IV secretion system protein VirB4      92   4e-17
hpj:jhp0917  virB4_2; DNA transfer protein; K03199 type IV s...    80   2e-13
nar:Saro_2162  ATPase                                              79   3e-13
bth:BT4770  conserved protein found in conjugate transposon        79   4e-13
bfr:BF0123  TraG                                                   77   1e-12
bfs:BF1767  traG; putative conserved protein found in conjug...    73   3e-11
bfr:BF1358  conserved protein found in conjugate transposon        65   5e-09
pgi:PG1481  conjugative transposon protein TraG                    65   8e-09
bth:BT0093  conserved protein found in conjugate transposon        65   8e-09
bfs:BF1241  conserved hypothetical protein found on conjugat...    64   1e-08
bch:Bcen2424_6801  conserved hypothetical protein                  64   1e-08
hpa:HPAG1_0520  cag pathogenicity island protein E                 62   7e-08
rsp:RSP_4226  traC; TraC                                           57   1e-06
eba:p1B154  traC; sex pilus assembly protein                       55   7e-06
>bqu:BQ10550 virB4; virB4 protein homolog; K03199 type IV secretion system
           protein VirB4
          Length = 784

 Score = 1560 bits (4039), Expect = 0.0
 Identities = 784/784 (100%), Positives = 784/784 (100%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT
Sbjct: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL
Sbjct: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH
Sbjct: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180

Query: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240
           EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF
Sbjct: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240

Query: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300
           GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI
Sbjct: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300

Query: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360
           DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE
Sbjct: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360

Query: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420
           AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY
Sbjct: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420

Query: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480
           FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK
Sbjct: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP
Sbjct: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540

Query: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600
           HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL
Sbjct: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600

Query: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660
           DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM
Sbjct: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
           LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE
Sbjct: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR
Sbjct: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780

Query: 781 RENQ 784
           RENQ
Sbjct: 781 RENQ 784
>bhe:BH13280 virB4; VirB4 protein homolog; K03199 type IV secretion system
           protein VirB4
          Length = 784

 Score = 1494 bits (3867), Expect = 0.0
 Identities = 745/784 (95%), Positives = 765/784 (97%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           MS+MKRESLPE+YIPYIRH+NQHVIALNSRCLMTVM VEGVNFDTADI+ LNSLHNQLNT
Sbjct: 1   MSMMKRESLPEDYIPYIRHINQHVIALNSRCLMTVMVVEGVNFDTADIDQLNSLHNQLNT 60

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           LL+NIADERVALYSHIIRRRETIYPES+FFSSFAATLDEKYKKKMVSQELYRNDLFVSLL
Sbjct: 61  LLKNIADERVALYSHIIRRRETIYPESQFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           WNP S KTEQLASFFQRL KAKKTQSEPD EAIRKIEELSQDLI+GLESY ARLLSVYAH
Sbjct: 121 WNPASDKTEQLASFFQRLAKAKKTQSEPDQEAIRKIEELSQDLIEGLESYGARLLSVYAH 180

Query: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240
            GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKE IEIRHESNERF GMF
Sbjct: 181 GGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKETIEIRHESNERFAGMF 240

Query: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300
           GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAA VIMGRKQNQMINAADRASSQI
Sbjct: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAASVIMGRKQNQMINAADRASSQI 300

Query: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360
           +ALDEALDDLESNRFVLGEHHLSLAVFA+ PK L EYLSKARAHLTNGGAVIAREDLGLE
Sbjct: 301 EALDEALDDLESNRFVLGEHHLSLAVFANHPKALAEYLSKARAHLTNGGAVIAREDLGLE 360

Query: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420
           AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG AVALLKTQAGSPYY
Sbjct: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGTAVALLKTQAGSPYY 420

Query: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480
           FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK
Sbjct: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           PLKNGQPTGIAPLKGMEYTEKNK+FLR+WVLKLVT EGQTVTE+ERQDIAKAI++L +LP
Sbjct: 481 PLKNGQPTGIAPLKGMEYTEKNKVFLRNWVLKLVTAEGQTVTEEERQDIAKAIDALGNLP 540

Query: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600
           HAQRSL ALQLFFDNTSKEGIAIRLQRW+KGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL
Sbjct: 541 HAQRSLSALQLFFDNTSKEGIAIRLQRWLKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600

Query: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660
           DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM
Sbjct: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
           LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE
Sbjct: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           SRRFLIKQGQ+SVVAELNLRGMNDEIA+LSGTTKNIELVNQII++YGADPD WLPIFHQR
Sbjct: 721 SRRFLIKQGQSSVVAELNLRGMNDEIAVLSGTTKNIELVNQIISEYGADPDIWLPIFHQR 780

Query: 781 RENQ 784
           RENQ
Sbjct: 781 RENQ 784
>mes:Meso_4346 type IV secretion/conjugal transfer ATPase, VirB4 family; K03199
           type IV secretion system protein VirB4
          Length = 793

 Score = 1011 bits (2613), Expect = 0.0
 Identities = 479/785 (61%), Positives = 626/785 (79%), Gaps = 5/785 (0%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           ++  RE  PE +IPY+RH+++ VIAL+SR LM V+A+EGV+F+TAD   LN+LH  LNTL
Sbjct: 6   TVRSRELEPETFIPYVRHIDERVIALDSRALMVVIALEGVSFETADTLDLNALHRDLNTL 65

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            RNIADER+AL++H++RRR+  YP+  F ++F+ TL++KY+ +M+ ++L+RNDL++SL+W
Sbjct: 66  YRNIADERLALWTHVVRRRDNEYPDGEFANAFSRTLNDKYRNRMIGEDLFRNDLYLSLVW 125

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE 181
           +P     E++A+F  RL KA++   E D++A++++++   D+  GL+ +  R+L++   +
Sbjct: 126 HPGKDAAERVAAFLSRLRKARRRGVELDVDALKRLDDTIVDVTAGLKRFGPRVLTLQERD 185

Query: 182 GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFG 241
           G++FSE SE LHQLVGGRRE +PLT G ++S IYSDRVI G+E +EIRHE + R+ GMFG
Sbjct: 186 GLVFSEPSEVLHQLVGGRREAVPLTEGRVSSAIYSDRVIVGRETVEIRHEGSSRYAGMFG 245

Query: 242 WKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQID 301
           +KEYP++TRPGM DGLLT P+E ILTQSF F SK+ A+ +MGRKQNQM++A D+A SQ++
Sbjct: 246 FKEYPARTRPGMFDGLLTVPYELILTQSFSFLSKSDAKTVMGRKQNQMVSAGDKAGSQLE 305

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LD+ALDDLESNRFVLG HHL+L VFA   + L + L+K+R HLTNGGAV+AREDLGLEA
Sbjct: 306 ELDDALDDLESNRFVLGNHHLTLTVFAGTVRELTDNLAKSRTHLTNGGAVVAREDLGLEA 365

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
           AWWAQLPGNF YR RSGAITS+NFAA SPFHS+P+G+ +GN WG AVA+LKT +GSP YF
Sbjct: 366 AWWAQLPGNFRYRVRSGAITSKNFAAFSPFHSYPVGQRDGNEWGPAVAMLKTASGSPLYF 425

Query: 422 NFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKP 481
           N HYGDLGNTF+ GPSGSGKTV++NF+L+Q +K +  +VFFDKD+GA++FVRA GG Y P
Sbjct: 426 NLHYGDLGNTFIGGPSGSGKTVLLNFILSQGEKFDANIVFFDKDRGADLFVRAAGGTYLP 485

Query: 482 LKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPH 541
           LKNG+PTG APLKGME T +NK+FL  WV KLV ++ + ++  E +DIA AI+ L  LP 
Sbjct: 486 LKNGRPTGCAPLKGMELTPENKVFLAQWVTKLVGSKTRELSVAETRDIANAIDGLADLPV 545

Query: 542 AQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL-----DSQFIGYDM 596
            +R++GAL+ F +NT  EGIA RL+RW +G  LGWVFDN  +D+ L       +F+GYDM
Sbjct: 546 ERRTIGALRTFLNNTDPEGIASRLRRWERGGPLGWVFDNVIEDIGLGDFGVGGKFVGYDM 605

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQ 656
           TDFLDNEEIR PLM YLF+R+  LIDGRRIIIVIDEFWKAL D+ F+  AQ++LKTIRKQ
Sbjct: 606 TDFLDNEEIRTPLMAYLFHRVEQLIDGRRIIIVIDEFWKALADEGFRDLAQNKLKTIRKQ 665

Query: 657 NGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSE 716
           NG+MLFATQSP+DA+NS IAHTIIEQCPTQ+F PN + +  DYV+ FKLTERE+ELI  E
Sbjct: 666 NGLMLFATQSPRDAINSPIAHTIIEQCPTQVFMPNSRGSRADYVDGFKLTEREYELIARE 725

Query: 717 LSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPI 776
           LS ESRRF++KQG NSVVAELNL G +DE+A+LSG T N+EL + I  + G DP+ WLP+
Sbjct: 726 LSNESRRFIVKQGHNSVVAELNLGGFDDELAVLSGRTANVELADTIRAETGDDPEAWLPL 785

Query: 777 FHQRR 781
           F Q+R
Sbjct: 786 FQQQR 790
>atc:AGR_pAT_223 virB4; virB4 type IV secretion protein; K03199 type IV secretion
           system protein VirB4
          Length = 795

 Score = 1009 bits (2610), Expect = 0.0
 Identities = 488/785 (62%), Positives = 625/785 (79%), Gaps = 5/785 (0%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           ++  RE  PE +IPY+RH+++  IAL SR LM ++A+ GV+F+TAD+  +N+LH  LNTL
Sbjct: 8   TLRSRELTPEAFIPYVRHIDETTIALESRTLMVMVALAGVSFETADLLDINALHRDLNTL 67

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            RNIADER+A+++H+IRRR++ YP   F + F+A+L+EKY+++M  + L+RNDL++++LW
Sbjct: 68  YRNIADERLAIWTHLIRRRDSDYPGGTFATPFSASLNEKYRERMAREHLFRNDLYLTVLW 127

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE 181
           +P     ++       L ++K+  +E D EA++++++    ++ GL S+E RLLS+Y  E
Sbjct: 128 SPARSPADKAGKLLSYLRRSKRLDTELDEEALKELKDKVVIVMAGLRSFEPRLLSLYEQE 187

Query: 182 GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFG 241
           G+LFSE SE LHQLVGGRRER+PLT G +AS IYSDRVI G+E IEIRHE+  RF GM  
Sbjct: 188 GMLFSEPSEVLHQLVGGRRERVPLTEGRVASAIYSDRVIIGRETIEIRHEAESRFAGMLS 247

Query: 242 WKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQID 301
           +KEYP++TR GM DG+L +PFE IL+QSF F SKA ARVIMGRKQNQ++++ D+A+SQID
Sbjct: 248 FKEYPARTRTGMLDGVLNSPFELILSQSFCFVSKADARVIMGRKQNQLVSSGDKAASQID 307

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LD+A+DDLESNRFVLGEHHL+L+VFA   K L + L+K RA LTNGGAV+AREDLGLEA
Sbjct: 308 ELDDAMDDLESNRFVLGEHHLTLSVFATTLKELTDNLAKVRASLTNGGAVVAREDLGLEA 367

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
           AWWAQLPGNF YRARSGAI+S+NFAALSPFHS+PIG+ +GN WG AVALLKT +GSPYYF
Sbjct: 368 AWWAQLPGNFRYRARSGAISSKNFAALSPFHSYPIGQKDGNEWGPAVALLKTASGSPYYF 427

Query: 422 NFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKP 481
           N HYGDLGNTF+CGPSG+GKTVIVNF+L+QL+KH+P +VFFDKD+GA+++VRA GG Y P
Sbjct: 428 NLHYGDLGNTFMCGPSGAGKTVIVNFMLSQLEKHDPHVVFFDKDRGADLYVRAAGGTYLP 487

Query: 482 LKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPH 541
           LKNG PTG APLK +  T +NK+FL  W+ KLV +  + +T  E +DI+ AI+ L  LP 
Sbjct: 488 LKNGVPTGCAPLKALNLTPENKVFLARWIGKLVGSGARELTVTELRDISGAIDGLADLPA 547

Query: 542 AQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL-----DSQFIGYDM 596
            +R++GAL+ F +NT  EGIA RL+RW +G  LGWVFDN  +D+         +FIGYDM
Sbjct: 548 ERRTIGALRAFLNNTDPEGIAARLRRWEEGGPLGWVFDNVIEDIGFGDFGGSGKFIGYDM 607

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQ 656
           TDFLDNEEIR PLM YLF+R+  +IDGRRIIIVIDEFWKAL+D+ F+  AQ++LKTIRKQ
Sbjct: 608 TDFLDNEEIRIPLMAYLFHRVEQVIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKTIRKQ 667

Query: 657 NGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSE 716
           NG+MLFATQSP+DALNS IAHTIIEQCPTQIF PN + N+ DYV+ FKLTERE+ELI  E
Sbjct: 668 NGLMLFATQSPRDALNSPIAHTIIEQCPTQIFLPNSRGNHADYVDGFKLTEREYELIARE 727

Query: 717 LSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPI 776
           LS ESRRF++KQG NSVVAEL+L G +DE+AILSG T N+EL++ I  + G D + WLPI
Sbjct: 728 LSVESRRFVLKQGHNSVVAELDLNGFDDELAILSGRTANVELLDAIRAEVGDDVENWLPI 787

Query: 777 FHQRR 781
           F QRR
Sbjct: 788 FQQRR 792
>sme:SMa1315 virB4; VirB4 type IV secretion protein; K03199 type IV secretion
           system protein VirB4
          Length = 792

 Score = 1006 bits (2602), Expect = 0.0
 Identities = 486/784 (61%), Positives = 625/784 (79%), Gaps = 4/784 (0%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           ++  RE  PE +IPY+RHV++  IAL+SR LM ++A+EGV+F+TADI  LN+LH  LNTL
Sbjct: 6   TLRSRELGPETFIPYVRHVDESTIALDSRALMVMIALEGVSFETADILDLNALHRDLNTL 65

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            RNIADER+AL++H+IRRR+  YPE  F + F+A L++KY+++MV ++L+RNDL++S+LW
Sbjct: 66  YRNIADERLALWTHLIRRRDNSYPEGTFATPFSAALNDKYRERMVGEDLFRNDLYLSILW 125

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE 181
           +P     ++ A    RL +A++  +E D  A++ + +   D+   L  +E R+L++Y H+
Sbjct: 126 SPARDPADKAAKLLSRLRRARRVGTELDEGALKHLRDKVIDVTAALRRFEPRVLTLYEHD 185

Query: 182 GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFG 241
           G++FSE SE LHQLVGGRRE IPLT G IAS IYSDRVI G+E IEIRHE++ R+ GM  
Sbjct: 186 GLMFSEPSEVLHQLVGGRREPIPLTEGHIASAIYSDRVIVGRETIEIRHEADSRYAGMLS 245

Query: 242 WKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQID 301
           +KEYP++TR GM D +LT+PFE IL QSF F SKA AR+IMGRKQNQM+++ D+A+SQI+
Sbjct: 246 FKEYPARTRTGMLDAVLTSPFELILAQSFSFVSKADARMIMGRKQNQMVSSGDKAASQIE 305

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LD A+DDLESNRFV GEHHL+L+VFA   K L + L+KARA +T+GGAV+AREDLGLEA
Sbjct: 306 ELDGAMDDLESNRFVFGEHHLTLSVFAPSVKELTDNLAKARASMTSGGAVVAREDLGLEA 365

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
           AWWAQLPGNF YRARSGAITSRNFAALSPFHS+P+G+ +GN WG AVALLKT +GSPYYF
Sbjct: 366 AWWAQLPGNFRYRARSGAITSRNFAALSPFHSYPLGQKDGNEWGPAVALLKTASGSPYYF 425

Query: 422 NFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKP 481
           NFHYGDLGNTFVCGPSG+GKTV++NF+L+QL+KH+P +VFFDKD+GA+++VRA GG Y P
Sbjct: 426 NFHYGDLGNTFVCGPSGAGKTVLLNFMLSQLEKHDPHVVFFDKDRGADLYVRAAGGTYLP 485

Query: 482 LKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPH 541
           LKNG PTG  PLK +E T +NK+FL  WV KLV +  + ++  E +DI+ AI+ L  LP 
Sbjct: 486 LKNGIPTGCTPLKALELTPENKVFLTRWVGKLVGSATRELSVTELRDISSAIDGLADLPV 545

Query: 542 AQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL----DSQFIGYDMT 597
            +R++GAL+ F DNT+ EGIA RL+RW +G  LGWVFDN  +D+        + +GYDMT
Sbjct: 546 ERRTIGALRTFLDNTNPEGIAARLRRWERGGPLGWVFDNVIEDIGFGEFGGGKLVGYDMT 605

Query: 598 DFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQN 657
           DFLDNEEIR PLM YLF+R+  LIDGRRIIIVIDEFWKAL+D+ F+  AQ++LKTIRKQN
Sbjct: 606 DFLDNEEIRAPLMAYLFHRVEQLIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKTIRKQN 665

Query: 658 GMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSEL 717
           G+MLFATQSP+DA+ S IAHTIIEQCPTQIF PN + N+ DYV+ FKLTEREFEL+  EL
Sbjct: 666 GLMLFATQSPRDAIVSPIAHTIIEQCPTQIFLPNSRGNHGDYVDGFKLTEREFELVAREL 725

Query: 718 SRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
           S ESRRF++KQG NSVVAEL+L+G++DE+AILSG T N+EL + I  + G++   WLP+F
Sbjct: 726 SIESRRFVLKQGHNSVVAELDLKGLDDELAILSGRTANVELADAIRAEVGSNAKDWLPVF 785

Query: 778 HQRR 781
            QRR
Sbjct: 786 QQRR 789
>atu:Atu5165 avhB4; agrobacterium virulence homologue virB4; K03199 type IV
           secretion system protein VirB4
          Length = 757

 Score =  977 bits (2525), Expect = 0.0
 Identities = 473/754 (62%), Positives = 603/754 (79%), Gaps = 5/754 (0%)

Query: 33  MTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRRETIYPESRFFSS 92
           M ++A+ GV+F+TAD+  +N+LH  LNTL RNIADER+A+++H+IRRR++ YP   F + 
Sbjct: 1   MVMVALAGVSFETADLLDINALHRDLNTLYRNIADERLAIWTHLIRRRDSDYPGGTFATP 60

Query: 93  FAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLASFFQRLTKAKKTQSEPDMEA 152
           F+A+L+EKY+++M  + L+RNDL++++LW+P     ++       L ++K+  +E D EA
Sbjct: 61  FSASLNEKYRERMAREHLFRNDLYLTVLWSPARSPADKAGKLLSYLRRSKRLDTELDEEA 120

Query: 153 IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIAS 212
           ++++++    ++ GL S+E RLLS+Y  EG+LFSE SE LHQLVGGRRER+PLT G +AS
Sbjct: 121 LKELKDKVVIVMAGLRSFEPRLLSLYEQEGMLFSEPSEVLHQLVGGRRERVPLTEGRVAS 180

Query: 213 TIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVF 272
            IYSDRVI G+E IEIRHE+  RF GM  +KEYP++TR GM DG+L +PFE IL+QSF F
Sbjct: 181 AIYSDRVIIGRETIEIRHEAESRFAGMLSFKEYPARTRTGMLDGVLNSPFELILSQSFCF 240

Query: 273 KSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPK 332
            SKA ARVIMGRKQNQ++++ D+A+SQID LD+A+DDLESNRFVLGEHHL+L+VFA   K
Sbjct: 241 VSKADARVIMGRKQNQLVSSGDKAASQIDELDDAMDDLESNRFVLGEHHLTLSVFATTLK 300

Query: 333 TLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFH 392
            L + L+K RA LTNGGAV+AREDLGLEAAWWAQLPGNF YRARSGAI+S+NFAALSPFH
Sbjct: 301 ELTDNLAKVRASLTNGGAVVAREDLGLEAAWWAQLPGNFRYRARSGAISSKNFAALSPFH 360

Query: 393 SFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQL 452
           S+PIG+ +GN WG AVALLKT +GSPYYFN HYGDLGNTF+CGPSG+GKTVIVNF+L+QL
Sbjct: 361 SYPIGQKDGNEWGPAVALLKTASGSPYYFNLHYGDLGNTFMCGPSGAGKTVIVNFMLSQL 420

Query: 453 QKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLK 512
           +KH+P +VFFDKD+GA+++VRA GG Y PLKNG PTG APLK +  T +NK+FL  W+ K
Sbjct: 421 EKHDPHVVFFDKDRGADLYVRAAGGTYLPLKNGVPTGCAPLKALNLTPENKVFLARWIGK 480

Query: 513 LVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGN 572
           LV +  + +T  E +DI+ AI+ L  LP  +R++GAL+ F +NT  EGIA RL+RW +G 
Sbjct: 481 LVGSGARELTVTELRDISGAIDGLADLPAERRTIGALRAFLNNTDPEGIAARLRRWEEGG 540

Query: 573 DLGWVFDNDQDDLNL-----DSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRII 627
            LGWVFDN  +D+         +FIGYDMTDFLDNEEIR PLM YLF+R+  +IDGRRII
Sbjct: 541 PLGWVFDNVIEDIGFGDFGGSGKFIGYDMTDFLDNEEIRIPLMAYLFHRVEQVIDGRRII 600

Query: 628 IVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQI 687
           IVIDEFWKAL+D+ F+  AQ++LKTIRKQNG+MLFATQSP+DALNS IAHTIIEQCPTQI
Sbjct: 601 IVIDEFWKALQDEGFRDLAQNKLKTIRKQNGLMLFATQSPRDALNSPIAHTIIEQCPTQI 660

Query: 688 FFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIA 747
           F PN + N+ DYV+ FKLTERE+ELI  ELS ESRRF++KQG NSVVAEL+L G +DE+A
Sbjct: 661 FLPNSRGNHADYVDGFKLTEREYELIARELSVESRRFVLKQGHNSVVAELDLNGFDDELA 720

Query: 748 ILSGTTKNIELVNQIINDYGADPDTWLPIFHQRR 781
           ILSG T N+EL++ I  + G D + WLPIF QRR
Sbjct: 721 ILSGRTANVELLDAIRAEVGDDVENWLPIFQQRR 754
>xfa:XFa0007 type IV secretion system protein VirB4; K03199 type IV secretion
           system protein VirB4
          Length = 815

 Score =  660 bits (1703), Expect = 0.0
 Identities = 357/805 (44%), Positives = 498/805 (61%), Gaps = 30/805 (3%)

Query: 4   MKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLR 63
           +K E     +IPY  HV ++V+ L +   +  + ++G   ++AD+  +NS H+QLN  +R
Sbjct: 11  LKNEKSTALFIPYSSHVTKNVVKLVNGDYIATIRMQGAAHESADVQDINSWHDQLNGFMR 70

Query: 64  NIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNP 123
           NIA    A++SH++RR    +P   +   F    +EKY+K M S+++  N+L++++++ P
Sbjct: 71  NIASPNTAVWSHVVRREYGEFPGGEYQPGFCHDFNEKYRKHMASEKMLVNELYLTVVYRP 130

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
              K  +    F   +KA K   +   E +  +E+L    +  L+ YE  L+  Y H+G 
Sbjct: 131 QPVKAVKFLDIFS--SKAPKELQQRQTEELEVVEDLISVALASLDRYEPELIGCYEHKGK 188

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKE-MIEIRHESNERFVGMFGW 242
           +FSE  EFL  LV G   R PL    I   + + R  FGK  ++ ++  ++ +F      
Sbjct: 189 MFSEVLEFLAFLVDGEWRRFPLPRTEIREVLATSRPFFGKGGLMSLKGPTSTQFCAAVTI 248

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDA 302
           +EYPS T PG+ + LL  PFEF+LTQSF F SK  A   M R+Q +M+N+ D A SQID 
Sbjct: 249 QEYPSITCPGILNELLGMPFEFVLTQSFSFISKPVAVGRMKRQQARMVNSGDVAGSQIDE 308

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           +D+ALDDL SNRFV+G HH S+ + A   K L E++S   A +++ G   ARED G+  A
Sbjct: 309 IDDALDDLTSNRFVMGVHHFSMMIRAHDQKALNEHISDTGAVMSDSGMKWAREDAGIAGA 368

Query: 363 WWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFN 422
           +W+QLPGNF YR R G ITSRNFA  S FH+FPIG++  N WG AV + KT +G+P+YFN
Sbjct: 369 FWSQLPGNFEYRVRVGDITSRNFAGFSSFHNFPIGRIRNNQWGDAVTMFKTTSGAPFYFN 428

Query: 423 FHYG-----------------DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNP-------T 458
           FH G                 DL NT V G SG GKTV+   LLAQ QK          +
Sbjct: 429 FHKGEEGADAKKSAKLDPNHKDLANTVVIGKSGMGKTVLEMMLLAQTQKFEQPQFGKKLS 488

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            V FDKD GA I VRA GG+Y PLKNG P+G  P + ME T  N  FL + + +LV  E 
Sbjct: 489 CVLFDKDLGAAIGVRAMGGRYYPLKNGVPSGFNPFQ-MEPTTSNLTFLETLIKQLVKHES 547

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVF 578
             +T ++ ++I++AI  +      +R +GAL  F D+T + G+  RL+RW +G  L W+F
Sbjct: 548 LPLTPRQEREISEAIAGVMGAAKQKRRIGALLEFLDSTDENGLHPRLERWCRGGTLAWLF 607

Query: 579 DNDQDDLNLDS-QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKAL 637
           DN  D L+LD+   +G+D+T+FLDN+  R P +MYLF+RI  LIDGRRI I +DEFWK L
Sbjct: 608 DNPVDTLSLDNCTIVGFDVTEFLDNDATRTPTIMYLFHRIESLIDGRRIPIFLDEFWKLL 667

Query: 638 EDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYK 697
            D +F+  AQ++L TIRKQ+G ++  TQSPK  L S IA+ II Q  T+IF PN +A+Y 
Sbjct: 668 NDPAFEDLAQNKLVTIRKQDGFLVMFTQSPKQVLKSPIAYAIIGQTATKIFLPNPEADYD 727

Query: 698 DYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIE 757
           DYV  FKLTEREFE+++S L  +SR+FLIKQGQNSVVAELNLRG +DE+A+LSG T    
Sbjct: 728 DYVNGFKLTEREFEIVKS-LGEKSRQFLIKQGQNSVVAELNLRGFDDELAVLSGNTATSL 786

Query: 758 LVNQIINDYGADPDTWLPIFHQRRE 782
           L  +++ + G DP  WLP FH+ R+
Sbjct: 787 LAEKLVAELGDDPAVWLPEFHRIRK 811
>bqu:BQ12580 trwK; trwK protein; K03199 type IV secretion system protein VirB4
          Length = 823

 Score =  583 bits (1504), Expect = e-165
 Identities = 328/802 (40%), Positives = 475/802 (59%), Gaps = 41/802 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IPY  HV   +I+  +   ++V  ++G +  +A    +     +LN  LR IA   ++L
Sbjct: 19  FIPYSHHVTDTIISTKNAEYLSVWKIDGRSHQSASEEDIFRWTKELNNTLRGIASANLSL 78

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           ++HI+RRR   YP+S F   F   LDEKY++  V   L  NDL++++++ P    T+++ 
Sbjct: 79  WTHIVRRRVYEYPDSTFDKIFCYQLDEKYRQSFVGYNLMVNDLYLTIVFQPV---TDKVM 135

Query: 133 SFFQRLTKAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEF 191
           SFF +  +    Q +   E+ I+ + ++++ L Q  + Y A LL  Y   G  +S   EF
Sbjct: 136 SFFSQHERETLDQKKMRQESCIKALNDINRTLSQSFKCYGAELLGAYEKNGHAYSSALEF 195

Query: 192 LHQLVGGRRERIPLTFGTIASTIYSDRVIFGK--EMIEIRHESNERFVGMFGWKEYPSKT 249
           L  LV G  + +P+     A  +  +R  F K   + E+R  +  R  GM   KEY + T
Sbjct: 196 LAMLVNGEYQPMPICHDRFADYMSINRPFFSKWGALGELRTTTGMRRFGMMEIKEYDTTT 255

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
           +PG  + LL + FEF+LTQSF   S+ AA+  + R Q  +I+A D A+SQI+ +DEAL+ 
Sbjct: 256 KPGQLNVLLESDFEFVLTQSFSVLSRHAAKDYLQRHQRNLIDARDVATSQIEQIDEALNQ 315

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
           L S  FV+GEHH +L ++ D  + + +Y++KA A + + G +    DL +EA +WAQLPG
Sbjct: 316 LVSGHFVMGEHHCTLTIYGDTIQQVRDYMAKANADMLDVGVLPKPVDLAIEAGYWAQLPG 375

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGD-- 427
           N+ +R R   ITS NF + S FH+F  GK  GN WG AV +LKT + +P YFNFH     
Sbjct: 376 NWKWRPRPAPITSLNFLSFSSFHNFMSGKPTGNPWGPAVTILKTISKTPLYFNFHASKLE 435

Query: 428 --------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY 479
                   LGNT + G SGSGKTV++ FLLAQ QK  PT V FDKD+G EI +RA GG+Y
Sbjct: 436 EDATNKRLLGNTAIIGQSGSGKTVLLGFLLAQAQKFKPTTVVFDKDRGMEIAIRAMGGRY 495

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLES- 538
              K G+P+   P + +  T+ N  FL+ +V KL    G+ +T ++ ++I +A+ S+ S 
Sbjct: 496 LTFKPGRPSSFNPFQ-LPPTQDNLTFLKQFVKKLAEAGGE-ITHRDEEEINQAVISIMSS 553

Query: 539 -LPHAQRSLGALQLFFDN------TSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDS-Q 590
            +  + R L  L  F  N       +   +  RL +W +  D GW+FDN QD L+L + Q
Sbjct: 554 NIDRSLRRLSFLLQFLPNPRSSHYNAHPSVHARLAKWCQNGDYGWLFDNPQDALDLSTHQ 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+D+T+FLDN E R P++MYLF R   +I G+R + + DEFWK+L+D  F+  A+++ 
Sbjct: 614 IYGFDITEFLDNPETRTPVIMYLFYRTEGMISGQRFMYIFDEFWKSLQDPYFEDLAKNKQ 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           KTIRKQNG+ +FATQ P DAL S IA T+I+QC T IF  N KA+Y+DY E FKLT+ EF
Sbjct: 674 KTIRKQNGIFVFATQEPSDALESNIAKTLIQQCATYIFLANPKASYEDYTEGFKLTDAEF 733

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNL-------------RGMNDEIAILSGTTKNIE 757
           EL++  L   SR+FLIKQG  S +AELNL             R  +DE+ +LSGT  N E
Sbjct: 734 ELVKG-LGEFSRQFLIKQGDQSALAELNLGKFNVTTDGKTIERDFSDELLVLSGTPDNAE 792

Query: 758 LVNQIINDYGADPDTWLPIFHQ 779
           LV  +I + G DP  WLP+F Q
Sbjct: 793 LVETLIAEVGDDPAVWLPVFLQ 814
>ret:RHE_PA00045 virB4a; transport secretion system IV, VirB4 protein; K03199 type
           IV secretion system protein VirB4
          Length = 789

 Score =  574 bits (1479), Expect = e-162
 Identities = 301/776 (38%), Positives = 465/776 (59%), Gaps = 11/776 (1%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E Y+PY+ H++ H++ L    +MT+  + GV F+  D    N+     NTLLRNIAD+ V
Sbjct: 13  EVYLPYVGHLSDHIVLLEDGSIMTMAHISGVAFELEDAEMRNARCRAFNTLLRNIADDHV 72

Query: 71  ALYSHIIRRRETIYPESRFF-SSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
           +LY+H++R  +     +R F S+F+A+L   ++++++  +L RND F++L+  P +    
Sbjct: 73  SLYAHLVRHDDVSPAPARHFRSAFSASLSGAFEQRVLCGQLLRNDHFLTLMVFPRTA--- 129

Query: 130 QLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQS 189
            L    ++  K    +       IR +E+L   +   LE Y  R L V   + +LFSE  
Sbjct: 130 -LGKVKRKFAKLYMKKENELAGQIRHLEDLWHVVAGALEEYGLRRLGVREKQDVLFSEVG 188

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           E L  ++ GR   +P+  G++ ++IY+DRVI GK  IEIR         ++ ++EYP++T
Sbjct: 189 EALRLVMTGRFAPVPVVSGSLGASIYTDRVICGKRGIEIRTPKESYVGSIYSFREYPART 248

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
           RPGM + LL+  F  +LTQSF F ++A A   +  K  QM+++ D+A +QI  L EA D 
Sbjct: 249 RPGMLNTLLSLDFPIVLTQSFSFLTRAQAHAKLSLKSRQMLSSGDKAVTQISELAEAEDA 308

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
           L SN+FV+G HHLSL ++A   ++L +  ++AR  L + GAV+ +E +G+EAA+W+QLPG
Sbjct: 309 LASNQFVMGSHHLSLCIYAKDLESLADKGARARTRLADAGAVVVQEGIGMEAAYWSQLPG 368

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDLG 429
           N  +R R GAI SRNFA L  F ++P G   G+ WG A+A  +T  G+P+ +  H  D+G
Sbjct: 369 NCRWRTRPGAINSRNFAGLVSFENYPEGARSGH-WGDAIARFRTNGGTPFDYIPHEHDVG 427

Query: 430 NTFVCGPSGSGKTVIVNFLLAQLQ----KHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNG 485
            T + GP G GKT ++ F+LA L+    +    +VFFDKD+G E+ VRA GG Y  L+ G
Sbjct: 428 MTAIFGPIGRGKTTLMTFILAMLEQSMLEREGAVVFFDKDRGGELLVRATGGTYLALRRG 487

Query: 486 QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ-TVTEQERQDIAKAINSLESLPHAQR 544
            P+G+APL+G+E T  ++ FLR W++ L+ ++G+  ++ +E + + + I+   S     R
Sbjct: 488 VPSGLAPLRGLENTAASRDFLREWLVALIESDGRGGISPEENRRLVRGIHRQLSFDPPMR 547

Query: 545 SLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEE 604
           S+  L+ F  +   EG   RLQRW +GN LGW FD + DD+ LD    G+DMT  L+ EE
Sbjct: 548 SIAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGELDDVRLDPSITGFDMTHLLEYEE 607

Query: 605 IRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFAT 664
           +  P   YL +RI  L+DGRR ++  DEF   L +  F A     L T+RK NGM++ AT
Sbjct: 608 VCAPAAAYLLHRIGALLDGRRFVMSCDEFRAYLLNPKFSAVIDKFLLTVRKNNGMLILAT 667

Query: 665 QSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRF 724
           Q P+  L S +  +++ QC T+IF+P+  AN   Y++  K TE+EF+ I+ E++  +R+F
Sbjct: 668 QQPEHVLESQLGASLVAQCMTKIFYPSPTANRSAYIDGLKCTEKEFQAIREEMAVGNRKF 727

Query: 725 LIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           L+K+   SV+ E +LR M + IA+LSG    +   +Q+    G DP  WL  F  R
Sbjct: 728 LLKRESGSVICEFDLREMREYIAVLSGRANTVRFADQLREARGEDPSAWLSEFMNR 783
>atc:AGR_pTi_8 virB4; VIRB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 789

 Score =  570 bits (1470), Expect = e-161
 Identities = 300/777 (38%), Positives = 473/777 (60%), Gaps = 13/777 (1%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E Y+PY+ HV+ H++ L    +MT+  V G+ F+  D    N+     NTLLRNIAD+ V
Sbjct: 13  EVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHV 72

Query: 71  ALYSHIIRRRETIYPESRFF-SSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
           ++Y+H++R  +     +R F S+F+A+L E ++++++S +L RND F++L+ +P +    
Sbjct: 73  SIYAHLVRHDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAA--- 129

Query: 130 QLASFFQRLTKAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQ 188
            L    +R TK  + Q E D+ A  R +E+L   +   LE+Y  R L +   + +LF+E 
Sbjct: 130 -LGKVRRRFTKRYR-QKENDLTAQTRNLEDLWHLVAGALEAYGLRRLGIREKQDVLFTEV 187

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
            E L  ++ GR   +P+  G++ ++IY+DRVI GK  +EIR   +     ++ ++EYP+ 
Sbjct: 188 GEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKDSYVGSIYSFREYPAT 247

Query: 249 TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALD 308
           TRPGM + LL+  F  +LTQSF F +++ A   +  K +QM+++ D+A +QI  L EA D
Sbjct: 248 TRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAED 307

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
            L SN FVLG HH+SL ++A+    L +  ++AR  L + GAV+ +E +G+EAA+W+QLP
Sbjct: 308 ALASNEFVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLP 367

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GN+ +R R GAITSRNFA L  F +FP G   G+ WG A+A  +T  G+P+ +  H  D+
Sbjct: 368 GNYKWRTRPGAITSRNFAGLVSFENFPEGSGSGH-WGNAIARFRTNGGTPFDYIPHEHDV 426

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQK----HNPTMVFFDKDQGAEIFVRAGGGKYKPLKN 484
           G T + GP G GKT ++ F+LA L++        +V FDKD+G+E+ VRA GG Y  L+ 
Sbjct: 427 GMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSELLVRATGGTYLALRR 486

Query: 485 GQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ-TVTEQERQDIAKAINSLESLPHAQ 543
           G P+G+APL+G+E T  +  FLR W++ L+ ++G+  ++ +E + + + I+   S     
Sbjct: 487 GAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHM 546

Query: 544 RSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE 603
           RS+  L+ F  +   EG   RLQRW +GN LGW FD + D++ LD    G+DMT  L+ E
Sbjct: 547 RSIAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYE 606

Query: 604 EIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFA 663
           E+      YL +RI  ++DGRR ++  DEF   L +  F A     L T+RK NGM++ A
Sbjct: 607 EVCAAAAAYLLHRIGAMVDGRRFVMSCDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILA 666

Query: 664 TQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRR 723
           TQ P+  L S +  +++ QC T+IF+P+  A+   Y++  K TE+EF+ I+ +++  SR+
Sbjct: 667 TQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMAVGSRK 726

Query: 724 FLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           FL+K+   SVV E +LR M + +A+LSG    +   +Q+    G +P  WL  F  R
Sbjct: 727 FLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMAR 783
>atu:Atu6170 virB4; component of type IV secretion system; K03199 type IV
           secretion system protein VirB4
          Length = 789

 Score =  570 bits (1470), Expect = e-161
 Identities = 300/777 (38%), Positives = 473/777 (60%), Gaps = 13/777 (1%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E Y+PY+ HV+ H++ L    +MT+  V G+ F+  D    N+     NTLLRNIAD+ V
Sbjct: 13  EVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHV 72

Query: 71  ALYSHIIRRRETIYPESRFF-SSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
           ++Y+H++R  +     +R F S+F+A+L E ++++++S +L RND F++L+ +P +    
Sbjct: 73  SIYAHLVRHDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAA--- 129

Query: 130 QLASFFQRLTKAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQ 188
            L    +R TK  + Q E D+ A  R +E+L   +   LE+Y  R L +   + +LF+E 
Sbjct: 130 -LGKVRRRFTKRYR-QKENDLTAQTRNLEDLWHLVAGALEAYGLRRLGIREKQDVLFTEV 187

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
            E L  ++ GR   +P+  G++ ++IY+DRVI GK  +EIR   +     ++ ++EYP+ 
Sbjct: 188 GEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKDSYVGSIYSFREYPAT 247

Query: 249 TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALD 308
           TRPGM + LL+  F  +LTQSF F +++ A   +  K +QM+++ D+A +QI  L EA D
Sbjct: 248 TRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAED 307

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
            L SN FVLG HH+SL ++A+    L +  ++AR  L + GAV+ +E +G+EAA+W+QLP
Sbjct: 308 ALASNEFVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLP 367

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GN+ +R R GAITSRNFA L  F +FP G   G+ WG A+A  +T  G+P+ +  H  D+
Sbjct: 368 GNYKWRTRPGAITSRNFAGLVSFENFPEGSGSGH-WGNAIARFRTNGGTPFDYIPHEHDV 426

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQK----HNPTMVFFDKDQGAEIFVRAGGGKYKPLKN 484
           G T + GP G GKT ++ F+LA L++        +V FDKD+G+E+ VRA GG Y  L+ 
Sbjct: 427 GMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSELLVRATGGTYLALRR 486

Query: 485 GQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ-TVTEQERQDIAKAINSLESLPHAQ 543
           G P+G+APL+G+E T  +  FLR W++ L+ ++G+  ++ +E + + + I+   S     
Sbjct: 487 GAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHM 546

Query: 544 RSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE 603
           RS+  L+ F  +   EG   RLQRW +GN LGW FD + D++ LD    G+DMT  L+ E
Sbjct: 547 RSIAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYE 606

Query: 604 EIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFA 663
           E+      YL +RI  ++DGRR ++  DEF   L +  F A     L T+RK NGM++ A
Sbjct: 607 EVCAAAAAYLLHRIGAMVDGRRFVMSCDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILA 666

Query: 664 TQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRR 723
           TQ P+  L S +  +++ QC T+IF+P+  A+   Y++  K TE+EF+ I+ +++  SR+
Sbjct: 667 TQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMAVGSRK 726

Query: 724 FLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           FL+K+   SVV E +LR M + +A+LSG    +   +Q+    G +P  WL  F  R
Sbjct: 727 FLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMAR 783
>bhe:BH15660 trwK; TrwK protein; K03199 type IV secretion system protein VirB4
          Length = 823

 Score =  569 bits (1466), Expect = e-160
 Identities = 324/801 (40%), Positives = 462/801 (57%), Gaps = 39/801 (4%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IPY  H+   +I+  +   +++  ++G +  +A    +     +LN  LR IA   ++L
Sbjct: 19  FIPYSHHITDTIISTKNAEYLSIWKIDGRSHQSASEEDIFQWARELNNTLRGIASANLSL 78

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           ++HI+RRR   YP+S F   F   LDEKY++      L  NDL++++++ P + K     
Sbjct: 79  WTHIVRRRVYEYPDSTFDKMFCYQLDEKYRQSFTGYNLMVNDLYLTVVFQPIADKVMSFF 138

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFL 192
           S  +R T  +K   +     I+ + ++++ L Q  + Y   LL  Y   G  +S   EFL
Sbjct: 139 SQHERETLDQKKMRQES--CIKALNDINRTLGQSFKRYGGELLGTYEKNGHAYSSALEFL 196

Query: 193 HQLVGGRRERIPLTFGTIASTIYSDRVIFGK--EMIEIRHESNERFVGMFGWKEYPSKTR 250
             LV G    +P+     A  +  +R  F K   + E+R  S  R  GM   KEY + T+
Sbjct: 197 AMLVNGEYSPMPICRDRFADYMSINRPFFSKWGALGELRTTSGIRRFGMMEIKEYDTTTK 256

Query: 251 PGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDL 310
           PG  + LL + FEF+LTQSF   S+ AA+  + R Q  +I+A D A+SQI+ +DEAL+ L
Sbjct: 257 PGQFNVLLESDFEFVLTQSFSVLSRHAAKDYLQRHQRNLIDARDVATSQIEQIDEALNQL 316

Query: 311 ESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGN 370
            S  FV+GEHH +L ++ D  + + +Y++KA A L     +    DL +EA +WAQLP N
Sbjct: 317 ISGHFVMGEHHCTLTIYGDTVQQVRDYMAKANAALLEVAVLPKPVDLAIEAGYWAQLPAN 376

Query: 371 FSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGD--- 427
           + +R R   ITS NF + S FH+F  GK  GN WG AV +LKT + +P YFNFH      
Sbjct: 377 WKWRPRPAPITSLNFLSFSSFHNFMSGKPTGNPWGPAVTILKTISKTPLYFNFHASKLEE 436

Query: 428 -------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480
                  LGNT + G SGSGKTV++ FLLAQ QK  PT V FDKD+G EI +RA GG+Y 
Sbjct: 437 DATDKRLLGNTAIIGQSGSGKTVLLGFLLAQAQKFKPTTVVFDKDRGMEIAIRAMGGRYL 496

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLES-- 538
             K G+ +G  P + +  T+ N  FL+ +V KL     + +T ++ ++I +A+ S+ S  
Sbjct: 497 TFKPGRQSGFNPFQ-LPPTQDNLTFLKQFVKKLAEASSE-ITHRDEEEINQAVMSIMSSN 554

Query: 539 LPHAQRSLGALQLFFDN------TSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDS-QF 591
           +  + R L  L  F  N       S   +  RL +W +G D GW+FDN  D L+L + Q 
Sbjct: 555 INPSLRRLSFLLQFLPNPHLNDYNSHPSVHTRLIKWCEGGDYGWLFDNPTDALDLSTHQI 614

Query: 592 IGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLK 651
            G+D+T+FLDN E R P+MMYL  R   +I G+R + + DEFWK L+D  F+  A+++ K
Sbjct: 615 YGFDITEFLDNPETRTPVMMYLLYRTEGMISGQRFMYIFDEFWKPLQDPYFEDLAKNKQK 674

Query: 652 TIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFE 711
           TIRKQNG+ +FATQ P DAL S IA T+I+QC T IF  N KANY+DY E FKLT+ EFE
Sbjct: 675 TIRKQNGIFVFATQEPTDALESNIAKTLIQQCATYIFLANPKANYEDYTEGFKLTDAEFE 734

Query: 712 LIQSELSRESRRFLIKQGQNSVVAELNL-------------RGMNDEIAILSGTTKNIEL 758
           LI+  +   SR+FLIKQG  S +AELNL             +  +DE+ +LSGT  N EL
Sbjct: 735 LIKG-IGEFSRQFLIKQGDQSALAELNLGKFHVTIDGKTVEQNFSDELLVLSGTPDNAEL 793

Query: 759 VNQIINDYGADPDTWLPIFHQ 779
           V  II + G DP  WLP+F Q
Sbjct: 794 VENIIAEVGDDPALWLPVFLQ 814
>bxe:Bxe_C0450 putative type IV secretion system protein VirB4/TraE
          Length = 823

 Score =  553 bits (1424), Expect = e-156
 Identities = 306/797 (38%), Positives = 447/797 (56%), Gaps = 22/797 (2%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           + + +RE +  +++P+  HV  HVI       ++V  + G+ F+ AD   +   H   N 
Sbjct: 8   IEVAEREVVLADFVPFSSHVTDHVIRTREGDYLSVWKIAGIAFEAADPGDILVRHEGFNQ 67

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           L+R++    V L+SH IRRR T +  + +   F   L  +Y        +  N+L+++L+
Sbjct: 68  LVRSLPGGHVGLWSHRIRRRVTDHFATPYGHPFCQELATRYYASFAGYRMMANELYLTLV 127

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           + P   +  +L  F Q   +          EA++ + EL+  +  GL+ ++   L VY  
Sbjct: 128 YRPRRTRLGRL--FSQAARRTLDDIRRDQHEALKVMAELAAQVESGLKPWDPVALGVYRK 185

Query: 181 E------GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
           +       + FS   EFL  LV    E +P+  G IA  + + R+ F  E +EIR     
Sbjct: 186 QIRYTQRPVRFSAALEFLGYLVNAAWEPVPVPSGRIAEALPTSRLFFRTEKVEIRMADAT 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+  +   K+YP +T PGM DGLL   FE+I TQSF    +  A+  + R++NQMI   D
Sbjct: 246 RYAALLDLKDYPEETEPGMLDGLLYGDFEYIETQSFTILDRPTAKEALERQRNQMIAGED 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQ+ A+D+ALDDL +  FVLGE+H SLAV  D+P  +  +++KAR  L + G   A 
Sbjct: 306 VAVSQVQAMDQALDDLINGDFVLGEYHYSLAVLGDRPDEVARHVAKARTQLADVGFQTAL 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
            DL  +AAW+AQLPGN+ YR R   +TSRNF  L+  H+F  GK EGN WG A+ ++KT 
Sbjct: 366 VDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGLASLHNFATGKREGNPWGEAITIVKTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDK 464
           +G P Y NFH             L NT + G +G+GKTV+  FLLA   K+  T V +DK
Sbjct: 426 SGQPLYLNFHATPEKKESADEKALANTQIIGQAGAGKTVLELFLLAMAMKYGLTGVVYDK 485

Query: 465 DQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQ 524
           D+G EI +RA GG+Y   + G PTG+ P + ++  E    F    V +LV T G  ++ +
Sbjct: 486 DRGTEIAIRAMGGRYTVFRRGVPTGLNPFQ-LDPDETVLDFWERLVRRLVDT-GTLLSAK 543

Query: 525 ERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDD 584
           +  DI++A+  +  +    R L  ++       +  +  RL +W  G  LGWV DN  D 
Sbjct: 544 DELDISRAVREVARMERPLRRLSMVRQLLPAVGENSLHARLTKWCAGGRLGWVLDNPSDL 603

Query: 585 LNL-DSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFK 643
           L+   ++  G+D T+ LD+ E+  P+ MYL      LIDGRR + V+ EFWK L D  F 
Sbjct: 604 LDFSQNRLFGFDDTELLDDPEVSTPVTMYLLQLTESLIDGRRFVYVMTEFWKRLGDPVFT 663

Query: 644 AFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDF 703
            FA+D+ KTIRKQNG+ +F TQSP D L S IA  ++EQ  T  F PN +A+Y DYV  F
Sbjct: 664 DFAKDKQKTIRKQNGLGIFDTQSPADVLRSDIARALVEQTATFFFLPNPRADYDDYVHGF 723

Query: 704 KLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQII 763
           KLTE EF +++S L   SR FL+KQG  S +  L+L G+ D + +LSGTT N+EL++ I 
Sbjct: 724 KLTEAEFNIVRS-LGENSRLFLVKQGHRSAIGRLDLAGLGDVLDVLSGTTDNVELLDGIR 782

Query: 764 NDYGADPDTWLPIFHQR 780
            + G DP  WLP+FH+R
Sbjct: 783 AEVGDDPGVWLPVFHER 799
>bch:Bcen2424_3315 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 826

 Score =  542 bits (1397), Expect = e-152
 Identities = 304/794 (38%), Positives = 447/794 (56%), Gaps = 22/794 (2%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +++ RE +  ++IP+  HV   VI       + +  + G+ F+TAD   + + H   N L
Sbjct: 9   TLVPREVVLADFIPFSSHVTDRVIRTREGDYIQIWKIPGIAFETADPADILARHVTFNQL 68

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
           +RN+    VAL++H +RRR     E+ + + F   L E+Y        +  N+L+VS ++
Sbjct: 69  VRNLPGGHVALWTHRLRRRTADRFETTYLNRFCQDLAERYYASFAGYTMMTNELYVSAVY 128

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE 181
            P   +  +L S   R T     + + D  A+R + +++  +  GL+ +    L VY   
Sbjct: 129 RPHRTRLGRLFSRAARRTVDDIQRDQQD--ALRALADIAAQIETGLKPWSPCALGVYERR 186

Query: 182 GIL------FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
             L      +S   E L  LV G  E +P+ +G I  T+ + R+ F +E +EIR  +  R
Sbjct: 187 DPLTKRLCRYSAALEMLGYLVNGTWEAVPVGYGRICDTLPTSRLFFHREKLEIRTPTRTR 246

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           +  +   K+YP +T PGM +GLL   FE+I TQSF    + +A+  + R++NQ+I   D 
Sbjct: 247 YAALLDLKDYPEQTEPGMLNGLLYGDFEYIETQSFTVLDRPSAKEALERQRNQLIAGDDV 306

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQI+A+D+A +DL +  FVLGE+H +LAV  D    +V ++++AR  L + G   A  
Sbjct: 307 AVSQIEAMDQAANDLVNGDFVLGEYHYTLAVLGDTLDEVVRHVAQARTKLADAGFQSALI 366

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
           DL  +AAW+AQ PGN+ YR R   +TSRNF A++  H+F  GK EGN WG A+ ++KT +
Sbjct: 367 DLVADAAWFAQCPGNWRYRPREAKLTSRNFCAMASLHNFATGKREGNPWGEAITIVKTPS 426

Query: 416 GSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKD 465
           G P Y NFH             L NT + G +G+GKTV+  FLLA   K+    V FDKD
Sbjct: 427 GQPLYLNFHATPEKVDSNDEKALANTQIIGRAGAGKTVLELFLLAMAMKYGVMGVLFDKD 486

Query: 466 QGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQE 525
           +GAEI +RA GG+Y     G+PTG+ P + +E  E    F    V KLV   G  ++ ++
Sbjct: 487 RGAEIGIRAMGGQYTVFHRGEPTGMNPFQ-LEADEATHSFWMRLVCKLV-DNGVPLSAKD 544

Query: 526 RQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDL 585
             DI++AI  +  +  + R L  ++    N     +  RL +W  G  LGWV DN  D +
Sbjct: 545 ELDISRAIREVARMDRSLRRLSMVRQLLPNVGDNSLHARLAKWCAGGRLGWVLDNPVDRI 604

Query: 586 NLDS-QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKA 644
           +LD+ +  G+D T+ LD+ E+  PL M L +    LIDGRR I V+ EFWK L D  F  
Sbjct: 605 DLDAHRLFGFDDTELLDDPEVCAPLTMVLLHLTERLIDGRRFIYVMTEFWKRLRDPVFSE 664

Query: 645 FAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFK 704
           FA D+ KTIRKQNG+ +F TQSP D L+S I+  ++EQ  T  F PN  A++ DYV  FK
Sbjct: 665 FANDKQKTIRKQNGLGIFDTQSPADVLSSPISRALVEQTATFFFLPNPSADHDDYVHGFK 724

Query: 705 LTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIIN 764
           LTE EF +++  +   SR FL+KQG  S +  L+L GM D + +LSGT+ N+ L+N I  
Sbjct: 725 LTEAEFNIVR-RMGEHSRLFLVKQGHRSAIGRLDLSGMGDVLDVLSGTSDNVALLNTIRA 783

Query: 765 DYGADPDTWLPIFH 778
             G DPD WLP FH
Sbjct: 784 KVGDDPDVWLPRFH 797
>bcn:Bcen_4851 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 826

 Score =  542 bits (1397), Expect = e-152
 Identities = 304/794 (38%), Positives = 447/794 (56%), Gaps = 22/794 (2%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +++ RE +  ++IP+  HV   VI       + +  + G+ F+TAD   + + H   N L
Sbjct: 9   TLVPREVVLADFIPFSSHVTDRVIRTREGDYIQIWKIPGIAFETADPADILARHVTFNQL 68

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
           +RN+    VAL++H +RRR     E+ + + F   L E+Y        +  N+L+VS ++
Sbjct: 69  VRNLPGGHVALWTHRLRRRTADRFETTYLNRFCQDLAERYYASFAGYTMMTNELYVSAVY 128

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE 181
            P   +  +L S   R T     + + D  A+R + +++  +  GL+ +    L VY   
Sbjct: 129 RPHRTRLGRLFSRAARRTVDDIQRDQQD--ALRALADIAAQIETGLKPWSPCALGVYERR 186

Query: 182 GIL------FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
             L      +S   E L  LV G  E +P+ +G I  T+ + R+ F +E +EIR  +  R
Sbjct: 187 DPLTKRLCRYSAALEMLGYLVNGTWEAVPVGYGRICDTLPTSRLFFHREKLEIRTPTRTR 246

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           +  +   K+YP +T PGM +GLL   FE+I TQSF    + +A+  + R++NQ+I   D 
Sbjct: 247 YAALLDLKDYPEQTEPGMLNGLLYGDFEYIETQSFTVLDRPSAKEALERQRNQLIAGDDV 306

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQI+A+D+A +DL +  FVLGE+H +LAV  D    +V ++++AR  L + G   A  
Sbjct: 307 AVSQIEAMDQAANDLVNGDFVLGEYHYTLAVLGDTLDEVVRHVAQARTKLADAGFQSALI 366

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
           DL  +AAW+AQ PGN+ YR R   +TSRNF A++  H+F  GK EGN WG A+ ++KT +
Sbjct: 367 DLVADAAWFAQCPGNWRYRPREAKLTSRNFCAMASLHNFATGKREGNPWGEAITIVKTPS 426

Query: 416 GSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKD 465
           G P Y NFH             L NT + G +G+GKTV+  FLLA   K+    V FDKD
Sbjct: 427 GQPLYLNFHATPEKVDSNDEKALANTQIIGRAGAGKTVLELFLLAMAMKYGVMGVLFDKD 486

Query: 466 QGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQE 525
           +GAEI +RA GG+Y     G+PTG+ P + +E  E    F    V KLV   G  ++ ++
Sbjct: 487 RGAEIGIRAMGGQYTVFHRGEPTGMNPFQ-LEADEATHSFWMRLVCKLV-DNGVPLSAKD 544

Query: 526 RQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDL 585
             DI++AI  +  +  + R L  ++    N     +  RL +W  G  LGWV DN  D +
Sbjct: 545 ELDISRAIREVARMDRSLRRLSMVRQLLPNVGDNSLHARLAKWCAGGRLGWVLDNPVDRI 604

Query: 586 NLDS-QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKA 644
           +LD+ +  G+D T+ LD+ E+  PL M L +    LIDGRR I V+ EFWK L D  F  
Sbjct: 605 DLDAHRLFGFDDTELLDDPEVCAPLTMVLLHLTERLIDGRRFIYVMTEFWKRLRDPVFSE 664

Query: 645 FAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFK 704
           FA D+ KTIRKQNG+ +F TQSP D L+S I+  ++EQ  T  F PN  A++ DYV  FK
Sbjct: 665 FANDKQKTIRKQNGLGIFDTQSPADVLSSPISRALVEQTATFFFLPNPSADHDDYVHGFK 724

Query: 705 LTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIIN 764
           LTE EF +++  +   SR FL+KQG  S +  L+L GM D + +LSGT+ N+ L+N I  
Sbjct: 725 LTEAEFNIVR-RMGEHSRLFLVKQGHRSAIGRLDLSGMGDVLDVLSGTSDNVALLNTIRA 783

Query: 765 DYGADPDTWLPIFH 778
             G DPD WLP FH
Sbjct: 784 KVGDDPDVWLPRFH 797
>bxe:Bxe_A1756 putative type IV secretion system protein VirB4/TraE
          Length = 830

 Score =  542 bits (1396), Expect = e-152
 Identities = 307/798 (38%), Positives = 443/798 (55%), Gaps = 24/798 (3%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           +++  RE     YIPY  HV +HVI       + V  + G+ F+ AD   + + H+  N 
Sbjct: 8   VAVANREVPLSGYIPYSTHVTEHVIKTREGDYLQVWKIAGIAFEAADPADILARHDGFNQ 67

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
            +R +A   VAL+SH +RRR +    + + + F   L  +Y        +  N+L+++++
Sbjct: 68  FVRGLAGGHVALWSHRLRRRVSDRFSTEYRNRFCEELATRYYASFAGYRMMANELYLTVV 127

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPD-MEAIRKIEELSQDLIQGLESYEARLLSVYA 179
           + P   +   L   F R  +  +     D ++A++ + EL+  +   L+ Y+   L VY 
Sbjct: 128 YRPNRTR---LGRVFSRAARRTRDDIRRDQLDALKVMAELAAQVESSLKPYDPVALGVYT 184

Query: 180 HEGIL------FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESN 233
            +         +S   E    LV G  ER P+  G I   + + R+  G E IEIR  + 
Sbjct: 185 RQSPFTPHPRRYSSALELFGYLVNGVWEREPVPSGPIREALPTSRLFVGAEKIEIRMPAA 244

Query: 234 ERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAA 293
            RF  M   K+YP  T PGM +GLL   FE+I TQSF    + +A+  + R++NQ+I   
Sbjct: 245 TRFAAMLDLKDYPEDTEPGMLNGLLYGDFEYIETQSFTILDRPSAKEALERQRNQLIAGE 304

Query: 294 DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIA 353
           D A SQ++A+D ALD+L +  FVLGE+H SLAV  D    +   ++KAR  L + G   A
Sbjct: 305 DVAVSQVEAMDRALDELVNGDFVLGEYHYSLAVLGDTLDEVSGSVAKARTQLADAGFQTA 364

Query: 354 REDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKT 413
             DL  +AAW+AQLPGN+ YR R   +TSRNF  LS  H+F  GK +GN WG A+ + KT
Sbjct: 365 LIDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGLSSLHNFATGKRDGNPWGEAITIFKT 424

Query: 414 QAGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFD 463
            +G P Y NFH             L NT + G +G+GKTV+  FLLA   K+  T V FD
Sbjct: 425 PSGQPLYLNFHVTPDKQDSLDEKALANTQIIGRAGAGKTVLELFLLAMATKYGITAVLFD 484

Query: 464 KDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTE 523
           KD+G EI +RA GG Y   + G+PTG+ P + ME  E    F    V KLV   G T++ 
Sbjct: 485 KDRGTEIAIRAMGGTYTVFRRGEPTGLNPFQ-MEPGEPVIDFWERLVRKLVDI-GVTLSA 542

Query: 524 QERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQD 583
           ++  DI++A+  +  +    R L  ++    N  +  +  RL +W  G  LGWVFDN  D
Sbjct: 543 KDELDISRAVREVARMDKPLRRLSMVRQLLPNVGENSLHARLAKWCAGGRLGWVFDNPTD 602

Query: 584 DLNL-DSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSF 642
            ++L  +   G+D T+ LD+ E+  P+ MYL +R  +LIDGRR + V+ EFWK L D  F
Sbjct: 603 RIDLAHATLFGFDDTELLDDAEVATPVTMYLLHRTENLIDGRRFVYVMTEFWKRLGDPVF 662

Query: 643 KAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVED 702
             FAQ++ KTIRKQNG+ +F TQSP D L S IA  +IEQ  T  F PN +A+Y DYV  
Sbjct: 663 TDFAQNKQKTIRKQNGLGIFDTQSPADVLRSPIASALIEQSATFFFLPNPRADYDDYVRG 722

Query: 703 FKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQI 762
           FKLTE EF ++++ L   SR FL+KQG  S +  L+L G+ D + +LSGT  N+EL++ I
Sbjct: 723 FKLTEAEFNIVRN-LGENSRMFLVKQGHRSAIGRLDLAGLGDVLDVLSGTIDNVELLDTI 781

Query: 763 INDYGADPDTWLPIFHQR 780
               G  P  W+P FH++
Sbjct: 782 RAQVGDLPQNWVPAFHEQ 799
>bxe:Bxe_A2655 putative type IV secretion system protein VirB4/TraE
          Length = 822

 Score =  542 bits (1396), Expect = e-152
 Identities = 306/797 (38%), Positives = 445/797 (55%), Gaps = 22/797 (2%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           +S+  RE     YIPY  HV  HVI       + V  + G+ F+ AD   + + H   N 
Sbjct: 8   LSVANREVPLAGYIPYSAHVTDHVIKTREGDYLQVWKIAGIAFEAADPADILARHEGFNQ 67

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           L+R +A   VAL+SH +RRR +    + + + F   L  +Y        +  N+L+++L+
Sbjct: 68  LVRGLAGGHVALWSHRLRRRVSDRFSTEYRNRFCEELATRYYASFAGYRMMANELYLTLV 127

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           + P   +  ++ S   R T+    + +  ++A++ + EL+  +   L+ Y+   L VY  
Sbjct: 128 YRPNRTRIGRVFSRAARRTRDDIRRDQ--LDALKVMSELAAQVESSLKPYDPVALGVYTR 185

Query: 181 EGIL------FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
           +         +S   E L  LV    ER P+    I   + + R+  G E +EIR  +  
Sbjct: 186 QSPFTPGPRRYSSALELLGYLVNAVWEREPVPAAPIREALPTSRLFVGAEKVEIRMPAAT 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           RF  M   K+YP  T PGM +GLL   FE+I TQSF    K +A+  + R++NQ+I   D
Sbjct: 246 RFAAMLDLKDYPEDTEPGMLNGLLYGDFEYIETQSFTILDKPSAKEALERQRNQLIAGED 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQ++A++ ALDDL +  FVLGE+H SLAV  D    +   ++KAR  L + G   A 
Sbjct: 306 VAVSQVEAMERALDDLINGDFVLGEYHYSLAVLGDTLDEVSRSVAKARTQLADAGFQTAL 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
            DL  +AAW+AQLPGN+ YR R   +TSRNF  LS  H+F  GK +GN WG A+ ++KT 
Sbjct: 366 IDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGLSSLHNFATGKRDGNPWGEAITIVKTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDK 464
           +G P Y NFH             L NT + G +G+GKTV+  FLLA   K+  T V FDK
Sbjct: 426 SGQPLYLNFHVTPDKQDSLDEKALANTQIIGRAGAGKTVLELFLLAMATKYGITSVLFDK 485

Query: 465 DQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQ 524
           D+G EI +RA GG Y   + G+PTG+ P + ME  E    F    V KLV   G + + +
Sbjct: 486 DRGTEIAIRAMGGTYTVFRRGEPTGLNPFQ-MEPGEPVIDFWERLVRKLVDV-GASPSAK 543

Query: 525 ERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDD 584
           +  DI++A+  +  +  + R L  ++    N  +  +  RL +W  G  LGWV DN  D 
Sbjct: 544 DELDISRAVREVARMDKSLRRLSMVRQLLPNVGENSLHARLAKWCVGGRLGWVLDNPSDR 603

Query: 585 LNL-DSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFK 643
           ++L  +   G+D T+ LD+ E+  P+ MYL +R  +LIDGRR I V+ EFWK L D  F 
Sbjct: 604 IDLAHADLFGFDDTELLDDAEVSTPVTMYLLHRTENLIDGRRFIYVMTEFWKRLGDPVFT 663

Query: 644 AFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDF 703
            FA ++ KTIRKQNG+ +F TQSP D L+S IA  ++EQ  T  F PN +A+Y DYV  F
Sbjct: 664 DFALNKQKTIRKQNGLGIFDTQSPADVLHSKIASALVEQSATLFFLPNPRADYDDYVHGF 723

Query: 704 KLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQII 763
           KLTE EF ++++ L   SR FL+KQG  S +  L+L G+ D + +LSGTT N+EL++ I 
Sbjct: 724 KLTEAEFNIVRN-LGENSRMFLVKQGHRSAIGRLDLGGLGDVLDVLSGTTDNVELLDTIR 782

Query: 764 NDYGADPDTWLPIFHQR 780
              G  P+ W+P+FH +
Sbjct: 783 AQVGDAPEDWVPVFHDQ 799
>rfe:RF_0088 virB4_1; type IV secretion/conjugal transfer ATPase, VirB4 family;
           K03199 type IV secretion system protein VirB4
          Length = 805

 Score =  526 bits (1354), Expect = e-147
 Identities = 297/789 (37%), Positives = 458/789 (58%), Gaps = 17/789 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           K+E     +IPY  H + + I      L+ V+ + G +F+TAD   L+   N  N LL+N
Sbjct: 15  KQERPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNVRNALLKN 74

Query: 65  IADERVALYSHIIRRRETIY---------PESRFFSSFAATLDEKYKKKMVSQELYRNDL 115
           +A   + +Y H IRRR+ +          P  +  + F   L  +++KK      + N+L
Sbjct: 75  MASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNEL 134

Query: 116 FVSLLWNPTSGKTEQLASFFQRLT-KAKKTQSEPDMEAIRK-IEELSQDLIQGLESYEAR 173
           +VS+L+ P +G    +  F ++L  K+ KT  E DM+ +++ ++E+S  ++    SY AR
Sbjct: 135 YVSILYKPDTGGAAIVEYFLKKLRQKSNKTAWENDMKEMKENLQEMSTRVVNTFRSYGAR 194

Query: 174 LLSVYAHEGILFSEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHE 231
           LL V   +   + E  EFL  L+  G     I L  GTI   + + R+ F    IE R  
Sbjct: 195 LLGVRQTQSGSYCEILEFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEARSP 254

Query: 232 SNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
             +++ GM    EY   T  G+ DG L  PFEF++TQSFVF ++  A   M  +QN+MI 
Sbjct: 255 LGKKYAGMISILEYGPNTSAGIFDGFLQMPFEFVMTQSFVFANRTVAIGKMQLQQNRMIQ 314

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           + D+A+SQI  ++ ALD   S     GEHHLSL   A+  K L + LS A   L+N G  
Sbjct: 315 SGDKATSQIAEINTALDMATSGDIGFGEHHLSLLCSANNIKALEDILSMAAVELSNSGIQ 374

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
             RE + +E ++W QLPGN  Y  R   I + N A+ +  H++P+GK+  N WG  V +L
Sbjct: 375 PVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVL 434

Query: 412 KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
            T +G+P+YFNFH  D+G+T + GP+G+GKTV++NFL A+ QK  P M FFDKD+GAEIF
Sbjct: 435 DTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIF 494

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA  G Y  +  G      PL+ +E T +N+ F+  W+  LVT+ G+++T Q+ + +++
Sbjct: 495 IRALNGVYTVIDPGLKCNFNPLQ-LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQ 553

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A++    L    R L  +  F    +   +A R+  W+       +FDN+ DD++L  ++
Sbjct: 554 AVSGNFRLEKKDRRLSNVIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEVDDIDLQKAR 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+DMT+ L +     P+++Y+F+RI   +DG++ +IV+DE W  +++  F    +D L
Sbjct: 614 VFGFDMTELLKDPVSLAPVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWL 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           K +RK N  ++FATQS +DA  S I+ T+I+Q  TQIF PN KA    Y   F L++RE+
Sbjct: 674 KVLRKLNTFVIFATQSVEDAAKSRISDTLIQQTATQIFLPNLKAT-DIYRSAFMLSQREY 732

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
            LI++  S  +R FLIKQG ++VVA++NL GMN+ I++LSG  + + L++QI   YG DP
Sbjct: 733 ILIKTTDS-TTRYFLIKQGIDAVVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDP 791

Query: 771 DTWLPIFHQ 779
           D WLPIF++
Sbjct: 792 DKWLPIFYE 800
>rpr:RP103 virB4; virB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 805

 Score =  525 bits (1353), Expect = e-147
 Identities = 293/789 (37%), Positives = 459/789 (58%), Gaps = 17/789 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           K+E     +IPY  H + + I      L+ V+ + G +F+TAD   L+   N  N LL+N
Sbjct: 15  KQERPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNALLKN 74

Query: 65  IADERVALYSHIIRRRETIY---------PESRFFSSFAATLDEKYKKKMVSQELYRNDL 115
           +A   + +Y H IRRR+ +          P  +  + F   L  +++KK      + N+L
Sbjct: 75  MASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNEL 134

Query: 116 FVSLLWNPTSGKTEQLASFFQRLT-KAKKTQSEPDMEAIRK-IEELSQDLIQGLESYEAR 173
           ++S+L+ P +G    +  F ++L  K+ KT  E DM+ +++ ++E+S  ++    SY A+
Sbjct: 135 YISILYKPDTGGAAIVEYFLKKLRQKSNKTAWENDMKEMKENLQEMSTRVVNTFRSYGAK 194

Query: 174 LLSVYAHEGILFSEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHE 231
           LL V   +  ++ E  EFL  L+  G     I L  GTI   + + R+ F    IE+R  
Sbjct: 195 LLGVRQTQSGIYCEILEFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEVRSP 254

Query: 232 SNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
             +++ G+    EY   T  G+ DG L  PFEF++TQSFVF ++  A   M  +QN+MI 
Sbjct: 255 LGKKYAGIISILEYGPNTSAGIFDGFLQMPFEFVMTQSFVFANRTVAIGKMKLQQNRMIQ 314

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           + D+A+SQI  ++ ALD   S     G+HHLSL   A   K L + LS A   L+N G  
Sbjct: 315 SGDKATSQIVEINTALDMATSGDIGFGDHHLSLLCSAKNIKALEDILSMAAVELSNSGIQ 374

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
             RE + +E ++W QLPGN  Y  R   I + N A+ +  H++P+GK+  N WG  V +L
Sbjct: 375 PVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVL 434

Query: 412 KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
            T +G+P+YFNFH  D+G+T + GP+G+GKTV++NFL A+ QK  P M FFDKD+GAEIF
Sbjct: 435 DTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIF 494

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA  G Y  +  G      PL  +E T +N+ F+  W+  LVT+ G+++T Q+ + +++
Sbjct: 495 IRALNGVYTVIDPGLKCNFNPLH-LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQ 553

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A+N    L    R L  +  F    +   +A R+  W+       +FDN+ DD++L  ++
Sbjct: 554 AVNGNFRLEKKDRRLSNVIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQRAR 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+DMT+ L +     P+++Y+F+RI   +DG++ +IV+DE W  +++  F    +D L
Sbjct: 614 VFGFDMTELLKDPVSLAPVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWL 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           K +RK N  ++FATQS +DA  S+I+ T+I+Q  TQIF PN KA    Y   F L++RE+
Sbjct: 674 KVLRKLNTFVIFATQSVEDAAKSSISDTLIQQTATQIFLPNLKAT-DIYRSAFMLSQREY 732

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
            LI++     +R FLIKQG ++VVA++NL GMN+ I++LSG  + + L++QI + YG DP
Sbjct: 733 ILIKT-TDPTTRYFLIKQGIDAVVAKVNLEGMNNIISVLSGRVETVMLLDQIRDKYGNDP 791

Query: 771 DTWLPIFHQ 779
           D WLPIF++
Sbjct: 792 DKWLPIFYE 800
>bms:BRA0066 virB4; type IV secretion system protein VirB4; K03199 type IV
           secretion system protein VirB4
          Length = 831

 Score =  525 bits (1352), Expect = e-147
 Identities = 312/806 (38%), Positives = 465/806 (57%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEELLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQ--QLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  +  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            S T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ASHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>bme:BMEII0028 ATPase virB4 homolog; K03199 type IV secretion system protein VirB4
          Length = 831

 Score =  524 bits (1350), Expect = e-147
 Identities = 312/806 (38%), Positives = 465/806 (57%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQK--LAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  S  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTASATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            + T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>bmb:BruAb2_0066 virB4; type IV secretion system protein VirB4; K03199 type IV
           secretion system protein VirB4
          Length = 831

 Score =  523 bits (1348), Expect = e-147
 Identities = 311/806 (38%), Positives = 465/806 (57%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQ--QLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  +  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            + T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>bmf:BAB2_0065 shikimate kinase:ATP/GTP-binding site motif A (P-loop):CagE, TrbE,
           VirB family component of type IV transporter system;
           K03199 type IV secretion system protein VirB4
          Length = 831

 Score =  523 bits (1348), Expect = e-147
 Identities = 311/806 (38%), Positives = 465/806 (57%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQ--QLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  +  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            + T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>ccr:CC2419 type IV secretion system protein B4, putative; K03199 type IV
           secretion system protein VirB4
          Length = 794

 Score =  522 bits (1344), Expect = e-146
 Identities = 292/775 (37%), Positives = 444/775 (57%), Gaps = 12/775 (1%)

Query: 6   RESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNI 65
           RE+   + +PY RH++   +      L+ V+ ++G+ F+T+D   L    +    LLR+ 
Sbjct: 17  REASIGDRLPYARHIDDLTLITRDGQLLQVIQLDGLAFETSDDQELTYRKHMREILLRSA 76

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTS 125
           A  R+ +Y H+IRR+     E      F+  LD+ ++ ++  + L+ N L+++L+  P  
Sbjct: 77  ASSRIIIYHHLIRRQVEPKSEPVRSDPFSQALDQAWRDRLAGRRLFVNQLYLTLVSRPAQ 136

Query: 126 GKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILF 185
           GK      +  RL +A    ++   + +R++  L + L  GL +Y AR L      G+  
Sbjct: 137 GKV----GWLDRLARAAPAGADAQAQDLRRLHSLRESLQAGLTAYGARTLGKQRVRGVER 192

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRH--ESNERFVGMFGWK 243
           SE   FL +++ G    +    G I   +   R+ FG + +EI    + + RF  +   K
Sbjct: 193 SEPCAFLAEILNGEPNTMATPSGDIGQALGDRRLTFGLDALEIGAGAKRDRRFGAIVSLK 252

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           +YP+++ PGM D +   P E ++T+SF F  + AA   MG    ++  A D A S  D L
Sbjct: 253 DYPARSAPGMFDAVFRLPAEMVMTESFSFLDRQAALDRMGLALRRLRAAEDDAFSLRDDL 312

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
             A D++ + R   GEHH+S+ V AD    L   ++  +A     GAV  RED+ LE A+
Sbjct: 313 TAARDEVGAGRSAFGEHHMSVLVKADSLAELDASVADLQAAFNEAGAVAVREDVNLEPAF 372

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
           WAQ PGNF + AR   I++ NFAA +  H+   GK EG  WG  V+LL+T A  PY+FNF
Sbjct: 373 WAQFPGNFKFIARKAMISAGNFAAFASLHNHSPGKAEGGPWGPPVSLLETTAHGPYHFNF 432

Query: 424 HYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLK 483
           H GDLGN  V GPSG+GKTV++ FLLAQ ++ +P +V+FDKD+GAE F+RA GG+Y  L+
Sbjct: 433 HNGDLGNFTVIGPSGAGKTVLLTFLLAQARRFDPQIVYFDKDRGAEPFIRAIGGRYDVLR 492

Query: 484 NGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQ 543
            G+P+G+ PL  M+ T  N+ F+  W+ +L+    + +  ++   IA A+++    P A 
Sbjct: 493 PGEPSGLNPLL-MDDTAANRAFVADWLAQLL-GGAERLEAEDLAMIADAVDANFDQPPAN 550

Query: 544 RSLGALQLFFDNTSKE---GIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600
           R L  L+  F    +     +A RL+ W +G +  W+FD+ +D + LD +  G+DMT  L
Sbjct: 551 RRLTFLRELFVGARRPRAGDLAARLRPWCEGGEHAWLFDSTEDLMRLDERAYGFDMTRIL 610

Query: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660
           D    R P MMYLF+RI   +DGR  IIV+DE WKAL+D  F    +D  KT+RK+NG++
Sbjct: 611 DAPITRTPAMMYLFHRIEQALDGRPTIIVVDEGWKALDDSIFTQRLKDWEKTLRKRNGVV 670

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
            F TQS  DAL S IA  I+EQ  TQIF PN KA   DY++ F LT  EF+L+++ L   
Sbjct: 671 GFCTQSAADALESRIASAIVEQAATQIFLPNPKAKPADYIDGFGLTPHEFDLVRA-LPDT 729

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLP 775
           SR FL+KQ  +S VA L+L G++D + +L+G  + +  ++Q+  + G DP  WLP
Sbjct: 730 SRCFLVKQADHSAVARLDLAGLDDVLTVLAGNERRVRRLDQVRAEVGDDPAAWLP 784
>rty:RT0033 virB4a; VirB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 805

 Score =  522 bits (1344), Expect = e-146
 Identities = 292/789 (37%), Positives = 460/789 (58%), Gaps = 17/789 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           K+E     +IPY  H + + I      L+ V+ + G +F+TAD   L+   N  N LL+N
Sbjct: 15  KQERPTSHFIPYRCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNALLKN 74

Query: 65  IADERVALYSHIIRRRETIY---------PESRFFSSFAATLDEKYKKKMVSQELYRNDL 115
           +A   + +Y H IRRR+ +          P  +  + F   L  +++KK    + + N+L
Sbjct: 75  MASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGAKSFFNEL 134

Query: 116 FVSLLWNPTSGKTEQLASFFQRLT-KAKKTQSEPDMEAIRK-IEELSQDLIQGLESYEAR 173
           ++S+L+ P +G    +  F ++L  K+ KT  E DM+ +++ ++E+S  +I    SY A+
Sbjct: 135 YISILYKPDTGGAAIVEYFLKKLRQKSNKTAWENDMKEMKENLQEMSTRVINTFRSYGAK 194

Query: 174 LLSVYAHEGILFSEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHE 231
           LL V   +  ++ E  EFL  L+  G     I L  GTI   + + R+ F    IE+R  
Sbjct: 195 LLGVRQTQSGIYCEILEFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEVRSP 254

Query: 232 SNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
             +++ G+    EY   T  G+ DG L  PFEF++TQSFVF ++  A   M  +QN+MI 
Sbjct: 255 FGKKYAGIISILEYGPNTSAGIFDGFLQMPFEFVMTQSFVFANRTVAIGKMKLQQNRMIQ 314

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           + D+A+SQI  ++ ALD   S     G+HHLSL   A   K L + LS A   L+N G  
Sbjct: 315 SGDKATSQIVEINTALDMATSGDIGFGDHHLSLLCSAKNIKALEDILSMAAVELSNSGIQ 374

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
             RE + +E ++W QLPGN  Y  R   I + N A+ +  H++P+GK+  N WG  V +L
Sbjct: 375 PVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVL 434

Query: 412 KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
            T +G+P+YFNFH  D+G+T + GP+G+GKTV++NFL A+ QK  P M FFDKD+GAEIF
Sbjct: 435 DTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIF 494

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA  G Y  +  G      PL  +E T +N+ F+  W+  LVT+ G+++T Q+ + +++
Sbjct: 495 IRALNGVYTVIDPGLKCNFNPLH-LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQ 553

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A++    L    R L  +  F    +   +A R+  W+       +FDN+ DD++L  ++
Sbjct: 554 AVSGNFRLEKKDRRLSNVIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQRAR 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+DMT+ L +     P+++Y+F+RI   +DG++ +IV+DE W  +++  F    +D L
Sbjct: 614 VFGFDMTELLKDPVSLAPVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWL 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           K +RK N  ++FATQS +DA  S+I+ T+I+Q  TQIF PN KA    Y   F L++RE+
Sbjct: 674 KVLRKLNTFVIFATQSVEDAAKSSISDTLIQQTATQIFLPNLKAT-DIYRSAFMLSQREY 732

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
            LI++     +R FLIKQG ++VVA++NL GM++ I++LSG  + + L++QI + YG DP
Sbjct: 733 ILIKT-TDPTTRYFLIKQGIDAVVAKVNLEGMDNIISVLSGRVETVILLDQIRDKYGNDP 791

Query: 771 DTWLPIFHQ 779
           D WLPIF++
Sbjct: 792 DKWLPIFYE 800
>rco:RC0141 virB4; virB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 805

 Score =  519 bits (1336), Expect = e-145
 Identities = 294/788 (37%), Positives = 456/788 (57%), Gaps = 17/788 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           K+E     +IPY  H + + I      L+ V+ + G +F+TAD   L+   N  N LL+N
Sbjct: 15  KQERPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNALLKN 74

Query: 65  IADERVALYSHIIRRRETIY---------PESRFFSSFAATLDEKYKKKMVSQELYRNDL 115
           +A   + +Y H IRRR+ +          P  +  + F   L  +++KK      + N+L
Sbjct: 75  MASGNIVMYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNEL 134

Query: 116 FVSLLWNPTSGKTEQLASFFQRLT-KAKKTQSEPDMEAIRK-IEELSQDLIQGLESYEAR 173
           +VS+L+ P +G    +  F ++L  K+ KT  E DM+ +++ ++E+S  +I    SY AR
Sbjct: 135 YVSILYKPDTGGVAIVEYFLKKLRQKSNKTAWENDMKEMKENLQEMSTRVINTFRSYGAR 194

Query: 174 LLSVYAHEGILFSEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHE 231
           LL V   +   + E  EFL  L+  G     I L  GTI   + + R+ F    IE R  
Sbjct: 195 LLGVRQTQSGSYCEILEFLSSLINCGDSPGPIALPRGTIDEYLPTHRLFFDSRTIEARSP 254

Query: 232 SNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
             +++ GM    EY   T  G+ DG L  PFEF++TQSFVF ++  A   M  +QN+MI 
Sbjct: 255 LGKKYAGMISILEYGPNTSAGIFDGFLQMPFEFVMTQSFVFVNRTVAIGKMQLQQNRMIQ 314

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           + D+A+SQI  ++ ALD   S     GEHHLSL   A+  K L + LS A   L+N G  
Sbjct: 315 SGDKATSQIAEINTALDMATSGDIAFGEHHLSLLCSANNIKALEDILSMAAVELSNSGIQ 374

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
             RE + +E ++W QLPGN  Y  R   I + N A+ +  H++P+GK+  N WG  V +L
Sbjct: 375 PVREKVNMEPSYWGQLPGNMDYIVRKSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVL 434

Query: 412 KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
            T +G+P+YFNFH  D+G+T + GP+G+GKTV++NFL A+ QK  P M FFDKD+GAEIF
Sbjct: 435 DTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIF 494

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA  G Y  +  G      PL+ +E T +N+ F+  W+  LVT+ G+++T Q+ + +++
Sbjct: 495 IRALNGVYTVIDPGLKCNFNPLQ-LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQ 553

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A++    L    R L  +  F    +   +A R+  W+       +FDN+ DD++L  ++
Sbjct: 554 AVSGNFRLAKQDRRLSNVIAFLGIDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQKAR 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+DMT+ L +     P+++Y+F+RI   +DG++ +IV+DE W  +++  F    +D L
Sbjct: 614 VFGFDMTELLKDPVSLAPVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWL 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           K +RK N  ++FATQS +DA  S I+ T+I+Q  TQIF PN KA    Y   F L++RE+
Sbjct: 674 KVLRKLNTFVIFATQSVEDAAKSRISDTLIQQTATQIFLPNLKAT-DIYRSAFMLSQREY 732

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
            LI++     +R FLIKQG ++VVA+++L GM++ I++LSG  + + L++QI   +G DP
Sbjct: 733 ILIKT-TDPTTRYFLIKQGIDAVVAKVSLDGMDNIISVLSGRVETVILLDQIREKHGNDP 791

Query: 771 DTWLPIFH 778
           D WLPIF+
Sbjct: 792 DKWLPIFY 799
>rbe:RBE_1266 virB4-1; VirB4; K03199 type IV secretion system protein VirB4
          Length = 805

 Score =  518 bits (1334), Expect = e-145
 Identities = 291/789 (36%), Positives = 454/789 (57%), Gaps = 17/789 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           K++     +IPY  H + + I      L+ V+ + G +F+TAD   L+   N  N LL+N
Sbjct: 15  KQDRPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNALLKN 74

Query: 65  IADERVALYSHIIRRRETIY---------PESRFFSSFAATLDEKYKKKMVSQELYRNDL 115
           +A   + +Y H IRRR+ +          P  +  + F   L  +++KK      + N+L
Sbjct: 75  MASGNIVVYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNEL 134

Query: 116 FVSLLWNPTSGKTEQLASFFQRLT-KAKKTQSEPDMEAIRK-IEELSQDLIQGLESYEAR 173
           +VS+L+ P +G    +  F ++L  K+ K   E DM+ +++ ++E+S  ++    SY AR
Sbjct: 135 YVSILYKPDTGGAAIVEYFLKKLRQKSNKNVWENDMKEMKENLQEMSNRIVNTFRSYGAR 194

Query: 174 LLSVYAHEGILFSEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHE 231
           +L V       + E  EFL  LV  G     + L   TI   + + R+ F    IE R  
Sbjct: 195 ILGVRKTPTGNYCEMLEFLSSLVNCGDSPGPVALPRSTIDEYLPTHRLFFDSRTIEARSS 254

Query: 232 SNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
              ++ G+    EY   T  G+ DG L  PFEF++TQSF+F ++  A   M  +QN+MI 
Sbjct: 255 IGTKYAGIISILEYGPTTSAGIFDGFLQMPFEFVMTQSFIFANRTVAIGKMQLQQNRMIQ 314

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           A D+A+SQI  +  ALD   S     GEHHLSL   A+  K L + LS A   L+N G  
Sbjct: 315 AGDKATSQIAEISTALDMATSGDIGFGEHHLSLLCSANSIKALEDILSMASVELSNSGIQ 374

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
             RE + +E ++W QLPGN  Y  R+  I + N A+ +  H++PIGK+  N WG  V +L
Sbjct: 375 PVREKINMEPSYWGQLPGNMEYIVRTSTINTLNMASFASQHNYPIGKVRNNHWGEYVTVL 434

Query: 412 KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
            T +G+P+YFNFH  D+G+T + GP+G+GKTV++NFL A+ QK  P M FFDKD+GAEIF
Sbjct: 435 DTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIF 494

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA  G Y  +  G      PL+ +E T +N+ F+  W+  LVT+ G+++T Q+ + +++
Sbjct: 495 IRALNGVYTVIDPGLKCNFNPLQ-LEDTSENRTFILEWLRVLVTSNGESITAQDNKILSQ 553

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A++    L    R L  +  F    + + +A R+  W+       VFDN+ DD++L  ++
Sbjct: 554 AVSGNFRLEKKDRRLSNVVAFLGIDTPDSLASRIAMWVGNGSHAKVFDNEVDDIDLQKAR 613

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRL 650
             G+DMT+ L +     P+++Y+F+RI   +DG++ +IV+DE W  +++  F    +D L
Sbjct: 614 VFGFDMTELLKDPISLAPVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWL 673

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
           K +RK N  ++FATQS +DA  S I+ T+I+Q  TQIF PN KA    Y   F L++RE+
Sbjct: 674 KVLRKLNTFVIFATQSVEDAAKSRISDTLIQQTATQIFLPNLKAT-DIYRSAFMLSQREY 732

Query: 711 ELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
            LI++     +R FL+KQG ++VVA++NL GMN+ I++LSG  + + L++QI   YG DP
Sbjct: 733 ILIKT-TDPTTRYFLVKQGVDAVVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDP 791

Query: 771 DTWLPIFHQ 779
           + WLPIF++
Sbjct: 792 EKWLPIFYE 800
>xcb:XC_1639 VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 817

 Score =  513 bits (1321), Expect = e-144
 Identities = 304/802 (37%), Positives = 461/802 (57%), Gaps = 43/802 (5%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE--- 68
           E++    HV   V+       + +  + G+ F   D   L   HN  N L++ +      
Sbjct: 10  EFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPDFA 69

Query: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPT-SGK 127
            VA + H +RRR  I    RF  SF   L ++Y   + SQ++ +N+L+ S+++ P  +GK
Sbjct: 70  NVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVTGK 129

Query: 128 TEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFS 186
                   ++     K + E + +AI K+ EL+ ++   L+ Y    L +Y A  G++FS
Sbjct: 130 R-----LVEKSGDPDKIRVEEE-QAIAKVIELATNVEAVLKDYSPYRLGMYEAKNGVVFS 183

Query: 187 EQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK---EMIEIRHESNERFVGMFGWK 243
           E  EFL  L+    E +P+    +A+ +   + +F     + +    +    F  +   K
Sbjct: 184 ETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNVK 243

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           EY   T PG+ +GL    FE+++T SF    +  A  ++ R +  MI++ D++SSQI  L
Sbjct: 244 EYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQIRDL 303

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
           D A+DD+ S  FVLGE+H ++AV++D  + L   ++  RA L+N G V ++EDL + +++
Sbjct: 304 DLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAIASSF 363

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
           ++QLPGN+ +R R   ++S NF  LSP H+F  GK   N WG AV  L+T  G PYYFNF
Sbjct: 364 YSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPYYFNF 423

Query: 424 H--------YGD--LGNTFVCGPSGSGKTVIVNFLLAQLQKHN--PTMVFFDKDQGAEIF 471
           H         G+  +GNT V G SG+GKT ++NFLL+Q+QK +  PT+ FFDKD+GAEIF
Sbjct: 424 HATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVPTIFFFDKDRGAEIF 483

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQT-VTEQERQDIA 530
           VRA GG Y  L+NG PTG  P +  E  E N  FL   +  L    G+T  + +E +DI 
Sbjct: 484 VRACGGNYLALENGSPTGFNPFQ-CESNEVNTQFLAELIKVL---GGKTEYSSREEEDIY 539

Query: 531 KAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-S 589
           +A+  +   P   RS+   +    N   +G+  RL+RW  GN LGWVFDN  D ++L  +
Sbjct: 540 RAVGGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRA 599

Query: 590 QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE-DDSFKAFAQD 648
             IG+D TD +DN E+R P++ YL +R+  LIDGR +I V+DEFWK L+ +   K FA++
Sbjct: 600 SIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGGLKEFAKN 659

Query: 649 RLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTER 708
           + KTIRKQNG+ +FATQSP+DAL S IA  +IEQ  T +  PN  A+  DY++  KLT+ 
Sbjct: 660 KQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYIDGLKLTDA 719

Query: 709 EFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA 768
           E++++ S L   SR FL+KQG  S V +LNLRGM+D ++++S +T NIE+++QI++    
Sbjct: 720 EYQVVVS-LDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILSRKAG 778

Query: 769 ---------DPDTWLPIFHQRR 781
                     P+ WL  F+  R
Sbjct: 779 KLGVSVGQLTPEQWLEDFYANR 800
>xcc:XCC2474 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 817

 Score =  513 bits (1321), Expect = e-144
 Identities = 304/802 (37%), Positives = 461/802 (57%), Gaps = 43/802 (5%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE--- 68
           E++    HV   V+       + +  + G+ F   D   L   HN  N L++ +      
Sbjct: 10  EFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPDFA 69

Query: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPT-SGK 127
            VA + H +RRR  I    RF  SF   L ++Y   + SQ++ +N+L+ S+++ P  +GK
Sbjct: 70  NVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVTGK 129

Query: 128 TEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFS 186
                   ++     K + E + +AI K+ EL+ ++   L+ Y    L +Y A  G++FS
Sbjct: 130 R-----LVEKSGDPDKIRVEEE-QAIAKVIELATNVEAVLKDYSPYRLGMYEAKNGVVFS 183

Query: 187 EQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK---EMIEIRHESNERFVGMFGWK 243
           E  EFL  L+    E +P+    +A+ +   + +F     + +    +    F  +   K
Sbjct: 184 ETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNVK 243

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           EY   T PG+ +GL    FE+++T SF    +  A  ++ R +  MI++ D++SSQI  L
Sbjct: 244 EYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQIRDL 303

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
           D A+DD+ S  FVLGE+H ++AV++D  + L   ++  RA L+N G V ++EDL + +++
Sbjct: 304 DLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAIASSF 363

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
           ++QLPGN+ +R R   ++S NF  LSP H+F  GK   N WG AV  L+T  G PYYFNF
Sbjct: 364 YSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPYYFNF 423

Query: 424 H--------YGD--LGNTFVCGPSGSGKTVIVNFLLAQLQKHN--PTMVFFDKDQGAEIF 471
           H         G+  +GNT V G SG+GKT ++NFLL+Q+QK +  PT+ FFDKD+GAEIF
Sbjct: 424 HATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVPTIFFFDKDRGAEIF 483

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQT-VTEQERQDIA 530
           VRA GG Y  L+NG PTG  P +  E  E N  FL   +  L    G+T  + +E +DI 
Sbjct: 484 VRACGGNYLALENGSPTGFNPFQ-CESNEVNTQFLAELIKVL---GGKTEYSSREEEDIY 539

Query: 531 KAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-S 589
           +A+  +   P   RS+   +    N   +G+  RL+RW  GN LGWVFDN  D ++L  +
Sbjct: 540 RAVGGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRA 599

Query: 590 QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE-DDSFKAFAQD 648
             IG+D TD +DN E+R P++ YL +R+  LIDGR +I V+DEFWK L+ +   K FA++
Sbjct: 600 SIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGGLKEFAKN 659

Query: 649 RLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTER 708
           + KTIRKQNG+ +FATQSP+DAL S IA  +IEQ  T +  PN  A+  DY++  KLT+ 
Sbjct: 660 KQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYIDGLKLTDA 719

Query: 709 EFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA 768
           E++++ S L   SR FL+KQG  S V +LNLRGM+D ++++S +T NIE+++QI++    
Sbjct: 720 EYQVVVS-LDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILSRKAG 778

Query: 769 ---------DPDTWLPIFHQRR 781
                     P+ WL  F+  R
Sbjct: 779 KLGVSVGQLTPEQWLEDFYANR 800
>xac:XAC2614 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 817

 Score =  511 bits (1315), Expect = e-143
 Identities = 301/802 (37%), Positives = 462/802 (57%), Gaps = 41/802 (5%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE--- 68
           E++    HV   V+   +   + +  + G+ F   D   L   HN  N LL+ +      
Sbjct: 10  EFVSISTHVAPSVVKTTAGDYLLIWHLGGLPFVGRDEFELEQRHNTFNRLLQTLRAPDFA 69

Query: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPT-SGK 127
            VA + H +RRR  I    RF  +F  TL ++Y   + SQ++ +N+L+ S+++ P  +G+
Sbjct: 70  NVAFWVHDVRRRRRIGAGGRFKQAFNQTLSDEYYTALSSQKIMQNELYFSMIYRPVVTGR 129

Query: 128 TEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFS 186
                   ++     K ++E + +A+ K+ EL+ ++   L+ Y    L +Y A  G++FS
Sbjct: 130 R-----LVEKSANPDKIRAEEE-QAVAKVVELATNVEAVLKDYAPYRLGMYEAKNGLVFS 183

Query: 187 EQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK---EMIEIRHESNERFVGMFGWK 243
           E  EFL  L+    E +P+    + + +   + +F     + +    +    F  +   K
Sbjct: 184 ETLEFLGYLLNRIDEPVPVLPAPVPAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNIK 243

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           EY   T PG+ +GL     E+++T SF    +  A  ++ R +  M+++ D++S+QI  L
Sbjct: 244 EYADGTYPGILNGLKYLDSEYVMTHSFSPVGRHDALKVLERTKGMMVSSGDKSSTQIRDL 303

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
           D A+DD+ S  FVLGE+H +LAV+AD  + L   ++  RA L+N G V A+EDL + +++
Sbjct: 304 DVAMDDVASGNFVLGEYHFTLAVYADSQEKLARQIATTRAELSNAGFVSAKEDLAIASSF 363

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
           ++QLPGN+ +R R   ++S NF  LSP H+F  GK   N WG  V  L+T  G PYYFNF
Sbjct: 364 YSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDCVTTLQTTNGQPYYFNF 423

Query: 424 H--------YGD--LGNTFVCGPSGSGKTVIVNFLLAQLQKHN--PTMVFFDKDQGAEIF 471
           H         G+  +GNT V G SG+GKT ++NFLL+Q+QK +  PT+ FFDKD+GAEIF
Sbjct: 424 HATHPSENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPIPTIFFFDKDRGAEIF 483

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           VRA GG Y  L+NG PTG  P +  E  E N  FL   ++K++  + +  + +E +DI +
Sbjct: 484 VRACGGNYLALENGSPTGFNPFQ-CERNEANTQFLAE-LIKVLGGKAE-YSAREEEDIYR 540

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQ 590
           A+  +   P   RS+   +    N   +G+  RL+RW  GN LGWVFDN  D ++L  + 
Sbjct: 541 AVEGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRAS 600

Query: 591 FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE-DDSFKAFAQDR 649
            IG+D TD +DN E+R P++ YL +R+  LIDGR +I V+DEFWK L+     K FA+++
Sbjct: 601 IIGFDYTDVIDNAEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGKGGLKEFAKNK 660

Query: 650 LKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTERE 709
            KTIRKQNG+ +FATQSP+DAL S IA  +IEQ  T I  PN  A+  DY+E  KLT+ E
Sbjct: 661 QKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMILLPNPNASRDDYMEGLKLTDAE 720

Query: 710 FELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA- 768
           ++++ S L   SR FL+KQG  S V +LNLRGM+D ++++S +T NIE+++QI+      
Sbjct: 721 YQVVVS-LDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILAGKAGK 779

Query: 769 --------DPDTWLPIFHQRRE 782
                    P+ WL  F+  R+
Sbjct: 780 LGVTVDQLTPEQWLADFYANRK 801
>nha:Nham_4445 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 803

 Score =  504 bits (1299), Expect = e-141
 Identities = 286/791 (36%), Positives = 448/791 (56%), Gaps = 12/791 (1%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           ++ +RE     ++PY RHV+ H+I      ++T + ++G +F+T+D++ +N+     N +
Sbjct: 14  AVSRRERPVASHVPYTRHVDDHIIKTRDGLVLTTLKLDGYSFETSDMSEVNARLLGRNDV 73

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
           +R +A+ R AL SHI+RR       S F ++    LDE+Y   +  + ++ ND++++++ 
Sbjct: 74  VRTLANSRFALVSHIVRREVQPRIVSTFDNALCRELDERYNAALSKRRMFVNDIYLTIIR 133

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPD--MEAIRKIEELSQDLIQGLESYEARLLSVYA 179
            P  G+     +   RL   K    E      A+ ++ + +  + + L  Y AR L V  
Sbjct: 134 RPLQGQAGTFDAMLTRLLGRKDVAGESVAMQTALAELRDAATAVRENLAGYGARQLGVVR 193

Query: 180 HEGILFSEQSEFLHQLVGGRRER-IPLTFGTIASTIYSDRVIFGKEMIEIRHESNE--RF 236
            +G+ FSE  EFL  L+ G   R + L    +A  +   R+ FG   IE+R    E  RF
Sbjct: 194 RDGVWFSEPLEFLTLLLNGGLPRPMHLPRMNLADALSMKRIFFGHNAIEVRGAGPEDTRF 253

Query: 237 VGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRA 296
             M   +EYP++T PG  D LL  P EFI TQSF    +  A   + R   Q+  + +  
Sbjct: 254 GAMVSIREYPAQTGPGSFDNLLRVPHEFIATQSFAIVDRPEAAKQIDRVSRQVDMSDEAG 313

Query: 297 SSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARED 356
           S   + LD+A D+L ++  + GEHH+++         +   ++   A LT+   +  RED
Sbjct: 314 SIVSEHLDDARDELLASEAIYGEHHMTVMCLGRDLAEVGAAVTAVGAALTDRSVIWTRED 373

Query: 357 LGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAG 416
           L  E A+WAQLPGNF+Y AR G I+S+NFA  +  H++P G+  GN WG A+++ +T + 
Sbjct: 374 LNCEPAFWAQLPGNFTYIARKGVISSKNFAGFTSLHNYPSGRPAGNHWGPAISVFETTSQ 433

Query: 417 SPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTMVFFDKDQGAEIFVRA 474
           + YY+N H  D+GN  V GP+GSGKTV ++F+ AQ Q+    P ++F DKD+GAEIF+RA
Sbjct: 434 TAYYYNHHVRDIGNFTVVGPTGSGKTVFLSFIAAQTQRIQPRPKLLFVDKDRGAEIFIRA 493

Query: 475 GGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAIN 534
            GG+Y+ L  G+ TG  PL   +     +   + +   L   +G  ++  E Q I  AI 
Sbjct: 494 LGGQYETLVPGEQTGFNPLSLPDSAPNREFLYQLFAFMLRPGKGGELSASEEQVIRNAIA 553

Query: 535 SLESLPHAQRSLGALQLFFDNTSKEG---IAIRLQRWIKGNDLGWVFDNDQDDLNLDSQF 591
           S  +   A R+L A         + G   +  RL+ W++ +  GW+F+ND+D  +L S F
Sbjct: 554 SALAAGPAGRTLKAFSTLLRGRIRAGEGDLLARLESWMRPDQRGWLFNNDEDRFSLSSVF 613

Query: 592 IGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLK 651
            G+DMT  LD+  +R   +MY+F+R  +L+ G  ++I +DE W+ L+D+ F  F +D+LK
Sbjct: 614 -GFDMTRVLDDPVVRTAALMYIFHRTDELLTGDPVMIFLDEGWRLLDDEVFAFFIRDKLK 672

Query: 652 TIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFE 711
           TIRKQNG++ F TQS  D + S  ++T+IEQ  T IFFPN KA+ + Y + F+L+ RE  
Sbjct: 673 TIRKQNGIVGFGTQSAADIVRSKASNTLIEQTSTNIFFPNPKADDESYKQAFRLSGREVA 732

Query: 712 LIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPD 771
            I+  +  ESR FLIK G++SVVA+LNL  M D I +LSG T+ +  ++ +    G DP 
Sbjct: 733 WIRGTVP-ESRSFLIKHGRDSVVAKLNLANMPDLIKVLSGRTETVAELDALRARVGDDPA 791

Query: 772 TWLPIFHQRRE 782
            WLPIF  R +
Sbjct: 792 AWLPIFMGRAQ 802
>aph:APH_0373 virB4-1; type IV secretion system protein VirB4
          Length = 801

 Score =  500 bits (1288), Expect = e-140
 Identities = 285/789 (36%), Positives = 446/789 (56%), Gaps = 11/789 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           I+ RE     ++PY  H N   +      L+ V+ + G  F+TAD   L+  ++  N  L
Sbjct: 15  IVNREYHQSNFLPYQEHWNSTTLVTKDGSLLKVIKLSGYAFETADDEDLSIQNSIRNQTL 74

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+++     LY HIIRRR   + E     +F S+FA  ++ +++ K ++++ + NDL+++
Sbjct: 75  RSMSSAAFGLYFHIIRRRRNAFSEGFAGKQFSSAFADAVNMQWRNKHMTKQSFTNDLYIT 134

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQS-EPDMEA-IRKIEELSQDLIQGLESYEARLLS 176
           ++   ++  TE   +  Q++ K   T+S + DM A    +EE++  ++  L +Y  R L 
Sbjct: 135 IVREGSNKSTELFVNLLQKINKKAATESWKNDMRAAFEDLEEVTNRVVTSLRNYAPRELG 194

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           + +     FSE  EFL Q+V  G    + +  G I+  +   R+ FG +++++      +
Sbjct: 195 IRSTPAGDFSEIMEFLLQIVNCGAVHNVAVDLGDISKYLPMHRLYFGHKVVQVVCHDGSK 254

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+EFI+TQSF F ++ AA   M  +QN+MI ++D+
Sbjct: 255 YAGLISLKEYGQTTSAGMLDAFLQLPYEFIITQSFKFTNRQAAITKMQIQQNRMIQSSDK 314

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQI  + +ALDD  S +   G HHL++      PK L   LS   A L+N G    RE
Sbjct: 315 AVSQIYEISKALDDAMSGKIAFGHHHLTVLCIEKTPKNLENALSLVEAELSNCGVYPVRE 374

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNFSY  R   I++ N A  +  H++P G+  GN WG AV +  T +
Sbjct: 375 KVNLEPAFWAQLPGNFSYVVRKAVISTLNMAGFASQHNYPSGQKFGNHWGEAVTVFDTTS 434

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++F+FH  D+G+T + GP+G+GKTV++NFL  Q  K +P + FFDKD GAEIF+RA 
Sbjct: 435 GTPFFFSFHMRDVGHTAIIGPTGAGKTVLMNFLCVQAMKFSPRVFFFDKDHGAEIFIRAL 494

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++    TG+ PL  ++ T  N+ FL  W   L TT    +T  +   I  AI  
Sbjct: 495 KGVYSIIETRGSTGLNPLH-LDDTPDNRGFLMEWFKLLATTLSDKLTPDDILRIDDAIEG 553

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL-DSQFIGY 594
              L    R L  L  F     ++ +A R+  W        +FDND+D L+   S+  G+
Sbjct: 554 NFKLKKEDRKLRNLVPFLGIGGEDTLASRMMMWHSEGSHAALFDNDEDVLDFTKSRVFGF 613

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M   L +     P ++YLF++I   +DG   +I++DE W  +++  F    +D LK +R
Sbjct: 614 EMGYLLKDPMALAPTLLYLFHKISISLDGTPSMIILDEAWALIDNPVFAPRIKDWLKVLR 673

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y + F LTERE+ LI+
Sbjct: 674 KLNTFVIFATQSVEDASKSQISDTLVQQTATQIFLPNLKAT-SAYRDVFMLTEREYSLIK 732

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG ++VVA ++LRG++D I +LSG  + + ++ +I+ + G DP+ WL
Sbjct: 733 -YTDPGTRFFLVKQGVSAVVARIDLRGLDDTINVLSGRAETVAILREIMEEVGDDPNVWL 791

Query: 775 PIFHQRREN 783
           PIF+QR +N
Sbjct: 792 PIFYQRVKN 800
>ech:ECH_0495 virB4-1; type IV secretion system protein VirB4
          Length = 800

 Score =  497 bits (1280), Expect = e-139
 Identities = 285/786 (36%), Positives = 441/786 (56%), Gaps = 11/786 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           ++KRE     +IPY  H N   +      ++ V+ + G  F+TAD   L+  ++  N +L
Sbjct: 14  VIKREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQML 73

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+I+     LY H+IRRR   + E     +  SSFA  ++ ++++K  +++ + NDL+++
Sbjct: 74  RSISSASFGLYFHVIRRRRNAFSEGFASDKVSSSFANYVNVRWREKHATKQSFTNDLYIT 133

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSE-PDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++        E L+S F +  K     S   D++AI + ++E++  +   L +Y  R+L 
Sbjct: 134 IVREGGKKGVEFLSSIFDKFGKVASQDSWIKDLQAISEDLDEVTNRVFTSLRNYAPRILG 193

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +      +FSE  EFL Q+V  G  +R+    G ++  +   R+ FG + I+I   +  +
Sbjct: 194 IRETPKGVFSEIMEFLLQVVNCGSFQRVLFHVGNVSKYLPMHRLYFGHKTIQIVAHNECK 253

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+EFI+TQSF F ++ +A   M  +QN+MI +AD+
Sbjct: 254 YAGLISLKEYGQTTSAGMLDAFLQLPYEFIITQSFKFTNRQSAITKMQIQQNRMIQSADK 313

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQ+  + +ALDD  S R   G+HHL++       KTL   LS   + L+N G    RE
Sbjct: 314 AVSQVVEISQALDDAMSGRIAFGQHHLTILCTERSLKTLDNALSLIESELSNCGVYPVRE 373

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNF Y  R   I++ N A  +  H++PIGK   N WG AV +  T +
Sbjct: 374 RVNLEPAFWAQLPGNFEYIVRKAIISTLNMAGFASQHNYPIGKKFNNHWGEAVTVFDTTS 433

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++FNFH  D+G+T + GP+G GKTV++NFL AQ  K +P + FFDKD GAEIF+RA 
Sbjct: 434 GTPFFFNFHIRDVGHTAIIGPTGGGKTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRAL 493

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++   PTG  PL  ++ T  N+ FL  W+  L++      T ++   I  AI  
Sbjct: 494 SGVYMVIEPRHPTGFNPLH-LDDTPDNRTFLMEWIKSLISVFNDKFTSEDITRINDAIEG 552

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGY 594
              L    R L  L  F        +A  +  W        +FDN +D L+ + S+  G+
Sbjct: 553 NFKLKKEHRVLCNLVPFLGLDGPNTLAGAISMWHSSGSHAAIFDNAEDLLDFNKSRVFGF 612

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M+  L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK +R
Sbjct: 613 EMSHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLR 672

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ LI+
Sbjct: 673 KLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SAYRNVFMLTEREYTLIK 731

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG  +VVA +NL G+ D I++LSG  + + +++ +I + G DP+ WL
Sbjct: 732 -HTDPSTRFFLVKQGVGAVVARINLSGLEDIISVLSGRAETVLMLHDLIKEVGDDPNVWL 790

Query: 775 PIFHQR 780
           PIF++R
Sbjct: 791 PIFYER 796
>ecn:Ecaj_0533 CagE, TrbE, VirB family component of typeIV transporter system;
           K03199 type IV secretion system protein VirB4
          Length = 800

 Score =  497 bits (1280), Expect = e-139
 Identities = 287/786 (36%), Positives = 443/786 (56%), Gaps = 11/786 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           ++ RE     +IPY  H N   +      ++ V+ + G  F+TAD   L+  ++  N +L
Sbjct: 14  VINREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQML 73

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+I+     LY HIIRRR   + E     +  SSFA  ++ K+++K  +++ + NDL+++
Sbjct: 74  RSISSASFGLYFHIIRRRRNAFSEGFASDKVASSFANYVNVKWREKHETKQSFTNDLYIT 133

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSE-PDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++        E L+S F +  K    +S   D++AI + ++E++  +   L +Y  R+L 
Sbjct: 134 IVRESGKQGVEFLSSIFGKFGKVASQESWIKDLQAIYEDLDEVTNRVFTSLRNYMPRVLG 193

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +      +FSE  EFL Q+V  G  +R+  + G ++  +   R+ FG + I+I   +  +
Sbjct: 194 IRETPKGVFSEIMEFLLQIVNCGSFQRVLFSIGDVSKYLPMHRLYFGHKTIQIVAHNECK 253

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+EFI+TQSF F ++ +A   M  +QN+MI +AD+
Sbjct: 254 YAGLISLKEYGQSTSAGMLDAFLQLPYEFIITQSFSFTNRQSAITKMQIQQNRMIQSADK 313

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQ+  + +ALDD  S R   G+HHL++       KTL   LS   + L+N G    RE
Sbjct: 314 AVSQVVEISQALDDAMSGRIAFGQHHLTILCTERSLKTLDNALSLIESELSNCGVYPVRE 373

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNF Y  R   I++ N A  +  H++PIGK   N WG AV +  T +
Sbjct: 374 RINLEPAFWAQLPGNFEYIVRKAIISTLNMAGFASQHNYPIGKKFNNHWGEAVTVFDTTS 433

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++FNFH  D+G+T + GP+G GKTV++NFL AQ  K +P + FFDKD GAEIF+RA 
Sbjct: 434 GTPFFFNFHIRDVGHTAIIGPTGGGKTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRAL 493

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++   PTG  PL+ ++ T  N+ FL  W+  L++      T ++   I  AI  
Sbjct: 494 SGVYMIVEPRNPTGFNPLQ-LDDTPDNRTFLMEWMKSLISVFNDKFTSEDITRINDAIEG 552

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGY 594
              L    R L  L  F        +A  +  W        +FDN +D L+ + S+  G+
Sbjct: 553 NFKLKKEHRVLCNLVPFLGLDGPNTLAGSISMWHSKGSHAAIFDNAEDLLDFNKSRVFGF 612

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M   L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK +R
Sbjct: 613 EMGHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLR 672

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ LI+
Sbjct: 673 KLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SAYRNVFMLTEREYTLIK 731

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG ++VVA +NL G+ D I++LSG  + + ++  +I + G DP+TWL
Sbjct: 732 -HTDPSTRFFLVKQGVSAVVARINLSGLEDVISVLSGRAETVLMLRDLIKEVGDDPNTWL 790

Query: 775 PIFHQR 780
           PIF++R
Sbjct: 791 PIFYER 796
>mlo:mlr9251 conjugal transfer protein; K03199 type IV secretion system protein
           VirB4
          Length = 803

 Score =  494 bits (1272), Expect = e-138
 Identities = 295/788 (37%), Positives = 455/788 (57%), Gaps = 17/788 (2%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           ++ +RE+    +IPY RHV+  VI      LM+ + + G+ F+T DI  +NS     N L
Sbjct: 15  AVSRRENPVSAHIPYSRHVSDEVIKTQDGMLMSFVHMSGLCFETIDIAEINSRLLGRNDL 74

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
           +R +A+ R A+YSHI+RR      ES F + F   LD++Y   + +Q ++ ND++++++ 
Sbjct: 75  IRGLANSRYAIYSHIVRREVKPAIESSFENKFCQELDQRYTAALRTQRMFVNDIYLTIVR 134

Query: 122 NPTSGKTEQLASFFQRLT--KAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYA 179
               G         ++L   +A   +S  +  A+ ++ ++ + + + L++Y AR+L+V  
Sbjct: 135 RELQGTVGTADLVIRKLLGRRAADGRSSSEERALIELTDVMKAVRESLQAYGARVLTVVK 194

Query: 180 HEGILFSEQSEFLHQLVGGRRER-IPLTFGTIASTIYSDRVIFGKEMIEIR--HESNERF 236
              +  SE  EFL QLV G   R + L    +A  + + R+ FG   +EIR       R+
Sbjct: 195 RNDVWHSEPLEFLVQLVNGGFPRPMALPRMKLAEALATKRLFFGPNALEIRGAFPGETRY 254

Query: 237 VGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRA 296
             +    EYPS T PGM + +L  P EFI+TQSF    K  A   M R   + I+ +D A
Sbjct: 255 GAIISVGEYPSITGPGMLNPMLKVPHEFIVTQSFAIIDKPQALTQMERV-GRKIDMSDEA 313

Query: 297 SSQI-DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
            S + D L EA D+L S+  + G HHL++         +   ++     LT   A+  RE
Sbjct: 314 DSIVGDQLGEARDELLSSEALYGLHHLTVLCLGKTMDDVARCVTDVGTALTEVSALWVRE 373

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
           DL  E A+WA LPGNF+Y AR   I+S+N A  S FH++P G+  G  WG  +++L+T +
Sbjct: 374 DLNCEPAFWATLPGNFAYVARKSMISSKNMAGFSAFHNYPSGRTGGVHWGMPISVLETTS 433

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTMVFFDKDQGAEIFVR 473
            + Y+FNFH  DLGN  + GPSGSGKTV++ FL AQ Q+    P +V  DKD+G +IFVR
Sbjct: 434 QTAYFFNFHVRDLGNFTLNGPSGSGKTVLLGFLAAQAQRITPRPKLVMIDKDRGLDIFVR 493

Query: 474 AGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFL-RSWVLKLVTTEGQTVTEQERQDIAKA 532
           + GG+Y+ LK G+P+G  PL+ +  T +N+ FL + +   L  ++G   + +E Q I  A
Sbjct: 494 SLGGRYEVLKAGEPSGFNPLR-LPDTPRNREFLFQLFSFILRRSDGYAHSTREEQVIRNA 552

Query: 533 INSLESLPHAQRSLGALQLFFDNTSKEG---IAIRLQRWIKGNDLGWVFDNDQDDLNLDS 589
           I  + S P   R++           + G   +  RLQ W++ +  GW+F+N +D  ++ S
Sbjct: 553 IAQVASAPPEGRTMEEFAELLRGAMRAGDDDLYSRLQPWMRPDQRGWLFNNAEDSFSMSS 612

Query: 590 QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDR 649
            F G+DMT  L +       ++Y+F+RI +L+DG+ ++I +DE WK L++D F  F +D+
Sbjct: 613 IF-GFDMTSVLSDATTSTAALLYIFHRIEELLDGQPVMIFLDEGWKLLDNDIFSYFIKDK 671

Query: 650 LKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTERE 709
           LKTIRK NG++ F TQS  D + S+IA+T+IEQ PT IFFPN KA+ + +   F L+ERE
Sbjct: 672 LKTIRKLNGIIGFGTQSAADIVKSSIANTLIEQTPTNIFFPNPKADEESH-RAFGLSERE 730

Query: 710 FELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGAD 769
            + I+ E   E+R+FLIK  Q+SV+A LNL  M D I ILSG  + ++ ++ +    G D
Sbjct: 731 IKWIR-ETPPEARKFLIKHDQDSVIARLNLGAMPDAIKILSGRIETVQELDALRARVGDD 789

Query: 770 PDTWLPIF 777
           PD WLP+F
Sbjct: 790 PDVWLPVF 797
>ama:AM814 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 802

 Score =  493 bits (1269), Expect = e-138
 Identities = 282/789 (35%), Positives = 445/789 (56%), Gaps = 11/789 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           +++RE     ++PY+ H N   +     C++ V+ + G  F+TAD   L+  ++  N  L
Sbjct: 16  VVERECHEAHFLPYLEHWNSTTLITKDGCMLKVIKLSGYAFETADDEDLSIQNSIRNQTL 75

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+++     LY HIIRRR+  +       +  ++FA  ++ ++++K +++  + N+L+++
Sbjct: 76  RSMSSSSFGLYFHIIRRRKDAFSHGFARGKLSNAFADAVNVQWREKHMTKPSFANELYIT 135

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQS-EPDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++ +     TE   +  ++ +K   +++ + DM AI + +EE +  ++  L +Y  R L 
Sbjct: 136 VVRDGGKKSTELFVNLMKKFSKKVTSEAWKNDMRAIYEDLEEATNRVVTSLRNYAPRELG 195

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +       FSE  EFL Q+V  G    + +  G I+  +   R+ FG +++++      +
Sbjct: 196 IRQTPSGDFSEIMEFLLQIVNCGTVHNVAMHLGDISRHLPMHRLYFGHKVVQVVGHDESK 255

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+EFI+TQSF F ++ AA   M  +QN+MI +AD+
Sbjct: 256 YAGLISLKEYGQTTSAGMLDAFLQLPYEFIITQSFKFTNRQAAITKMQIQQNRMIQSADK 315

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQI  + +ALDD  S +   G HHL++      PK L   LS   A L+N G    RE
Sbjct: 316 AVSQIYEISKALDDATSGKIAFGLHHLTVLCIEKNPKNLENALSLVEAELSNCGVYPVRE 375

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNFSY  R   I++ N A  +  H++PIGK   N WG AV +  T +
Sbjct: 376 KVNLEPAFWAQLPGNFSYVVRKAVISTLNMAGFASQHNYPIGKKFDNHWGEAVTVFDTTS 435

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++F+FH  D+G+T + GP+G GKTV++NFL  Q  K +P + FFDKD GAEIF+RA 
Sbjct: 436 GTPFFFSFHIRDVGHTAIIGPTGGGKTVLMNFLCVQAMKFSPRIFFFDKDHGAEIFIRAL 495

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++    TG+ PL  ++ T +N+ FL  W+  L TT    +T  +   I  AI  
Sbjct: 496 NGIYSVVEPRGNTGLNPLH-LDDTTENRTFLMEWMKVLATTLSSDLTPDDILRINDAIEG 554

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL-DSQFIGY 594
              L    R L  L  F      + +A R+  W        +FDN++D L+   S+  G+
Sbjct: 555 NFKLRKEDRMLRNLVPFLGIGGADTLAGRMMMWHSEGSHAALFDNEEDLLDFTKSRVFGF 614

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M + L +     P ++YLF++I   +DG   II++DE W  +++  F    +D LK +R
Sbjct: 615 EMGNLLKDPAALAPTLLYLFHKISISLDGTPSIIILDEAWALIDNPVFAPRIKDWLKVLR 674

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y + F LTERE+ LI+
Sbjct: 675 KLNTFVIFATQSVEDASKSQISDTLVQQTATQIFLPNLKAT-SAYRDVFMLTEREYSLIK 733

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 SR FL+KQG ++VVA ++LRG+ D I +LSG  + + ++N+II   G DP+ WL
Sbjct: 734 -YTDPGSRFFLVKQGVSAVVARIDLRGLEDTINVLSGRAETVLMLNEIIEKVGRDPNVWL 792

Query: 775 PIFHQRREN 783
           PIF Q+  N
Sbjct: 793 PIFCQKVRN 801
>bpe:BP3790 putative bacterial secretion system protein; K03199 type IV
           secretion system protein VirB4
          Length = 824

 Score =  490 bits (1262), Expect = e-137
 Identities = 284/813 (34%), Positives = 460/813 (56%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGENHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMMELRAPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR+R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRSRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
>bpa:BPP4311 putative bacterial secretion system protein; K03199 type IV
           secretion system protein VirB4
          Length = 824

 Score =  490 bits (1261), Expect = e-137
 Identities = 284/813 (34%), Positives = 459/813 (56%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGENHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMMELRSPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
>vfi:VFB39 VirB4 ATPase; K03199 type IV secretion system protein VirB4
          Length = 817

 Score =  490 bits (1261), Expect = e-137
 Identities = 295/793 (37%), Positives = 450/793 (56%), Gaps = 40/793 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           YIPY  H+   ++      L+ +  + GV F+T D   L+ LH +LNTL + +++  V+L
Sbjct: 19  YIPYSSHLTDSILITTDGDLLQMFRLSGVAFETKDNEELSLLHQRLNTLYKGLSESDVSL 78

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           ++H+IRR+        F   FAA  D  Y  +   +E+  N+ +V+++   T        
Sbjct: 79  WTHVIRRKVKHTINGEFNQHFAAHFDAVYNAQF-GEEIMTNEFYVTVIQRSTD------- 130

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQ--DLIQG-LESYEARLLSVYAHE-GILFSEQ 188
               RL K  +         + +I+  ++  DLI+  LESY    L+   ++ G + SE 
Sbjct: 131 ----RLKKLNRNIDAIKARLVERIDAFTEVTDLIKNNLESYHPTSLTCKTNQQGTVLSEP 186

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
              L+ L+      +    G I   I +  +  G + IE+   S+  +      KEY S+
Sbjct: 187 LTVLNYLLTHEWVNVHKPTGEIKHAIGNAWIKIGSDTIELNSVSSTHYAQGIDIKEYASR 246

Query: 249 TRPGMTDGLLTAPFEFILTQSF-VFKSKAAARVIMGRKQNQMINAADRASSQIDALDEAL 307
           +  G+ +GLL + FEF+LTQSF ++  K AA+ I  +K+    ++ D A +QI  LD+A 
Sbjct: 247 SYNGLLNGLLYSEFEFVLTQSFSLYPRKIAAKFIKTQKRRGK-SSGDGAITQIQDLDQAS 305

Query: 308 DDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQL 367
           +DL    F +GE+H SL VF D    + +Y S+A+  L++   +     +  +AA++AQL
Sbjct: 306 NDLLDGHFAMGEYHFSLLVFGDSIDNVRQYRSEAQKSLSHSELLCVPIKIATDAAFFAQL 365

Query: 368 PGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY-- 425
           P N+ YR R   +TSRNFA+ SPFH+F IGK EGN WG AV  LKT +G P+YFNFHY  
Sbjct: 366 PANWGYRPRVVGLTSRNFASFSPFHNFLIGKKEGNPWGDAVTRLKTLSGHPFYFNFHYTL 425

Query: 426 -GD-------LGNTFVCGPSGSGKTVIVNFLLAQLQK---HNP-TMVFFDKDQGAEIFVR 473
            GD        GNT + G +G+GKTV +  L  Q QK   H+P + VFFDKD+GAE+ +R
Sbjct: 426 TGDDNFNEKVAGNTRMIGMTGTGKTVALGLLYCQAQKYAQHSPFSTVFFDKDRGAEVMIR 485

Query: 474 AGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAI 533
           A GG Y  ++NG+ TG  PL+ M  T +N  FL+ WV +LV ++   +T  + + I++A+
Sbjct: 486 ALGGNYLRVQNGKQTGFNPLQ-MNPTPQNISFLKRWVRQLVESKQHPLTTLDERSISQAV 544

Query: 534 NSLESLPHAQRSLGAL-QLFFDNTSKE----GIAIRLQRWIKGNDLGWVFDNDQDDLNLD 588
           +++  +    R L  + Q     TSKE     I  RL +W +G +  WVFDND D L+ +
Sbjct: 545 DTVMRMEKPLRRLTLINQNIAVGTSKEERENSIKARLDKWCQGGEFAWVFDNDVDLLDFN 604

Query: 589 SQF-IGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ 647
           S   IG D T+FLDN +IR P+ +YL +R+ ++IDGRR   V+DE WK + DD+F  F  
Sbjct: 605 SATNIGIDGTEFLDNHDIRTPICLYLLHRMDEVIDGRRFFYVMDEAWKWVNDDAFSDFVG 664

Query: 648 DRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTE 707
           ++  TIRKQNG  +FATQ P   L S     +IE C T+I+ PN KA + +YV D  L+E
Sbjct: 665 NKQLTIRKQNGFGVFATQLPSSLLGSPQGAALIESCSTEIYLPNPKAKHDEYVTDLGLSE 724

Query: 708 REFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYG 767
           +EF +++ E   +SR  LIKQG  S +  L + GM++E+ +LS ++  + L ++ I + G
Sbjct: 725 KEFSILK-EFGEKSRLCLIKQGNQSAICSLTMPGMSNELTLLSASSDELPLFDESIKEVG 783

Query: 768 ADPDTWLPIFHQR 780
            +P  W+PIF Q+
Sbjct: 784 ENPIDWIPIFLQK 796
>bbr:BB4897 putative bacterial secretion system protein; K03199 type IV
           secretion system protein VirB4
          Length = 824

 Score =  489 bits (1260), Expect = e-137
 Identities = 284/813 (34%), Positives = 459/813 (56%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGEDHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPLDAYLGSSRILAGAEMMELRSPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
>eli:ELI_03225 type IV secretion system protein B4, putative
          Length = 812

 Score =  489 bits (1258), Expect = e-136
 Identities = 285/776 (36%), Positives = 429/776 (55%), Gaps = 13/776 (1%)

Query: 6   RESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNI 65
           +E+   + +PY R V+ + + L    LM  + V G+ F+T D + LN+       +LR+ 
Sbjct: 13  KEASAGDRLPYARLVDANTLQLRDGSLMMAIQVPGLLFETEDSDALNAHAATREVVLRST 72

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTS 125
            D R  LY H+IRRR  +  ++ F    +  +D ++K+++ S  L+ ND FV+L+  P  
Sbjct: 73  LDSRFVLYHHVIRRRVAVELDAEFPDPLSRHIDARWKERLGSGSLFINDQFVTLVRRPAR 132

Query: 126 GKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGIL 184
           GK   LA    R    +K + E D   +R ++  +  LI  L++Y A LL  Y    G  
Sbjct: 133 GKAG-LADRASRWFSRRKEELEADPRELRSLQAAATGLIASLQAYGASLLGEYQGPSGGT 191

Query: 185 FSEQSEFLHQLVGGRRE--RIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
            SE  E L  L  G  +  R P     I   +   R  FG + +E R   +  F  +   
Sbjct: 192 NSEILELLSALYNGEMKPVRRPAEDVDIGQMLPYRRASFGLDAMEQRGAGDPDFSAILSL 251

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDA 302
           K+YP  T PG+ D LL  P+E I+T+++  + +  AR  +     ++ +  + A+++   
Sbjct: 252 KDYPEATSPGLLDSLLRLPYEMIVTETYAPQERTTARERIDLSLRRLRSVDEEATAERAD 311

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           +  A D L +     G+HHLS+ V       L +  +   A L + GAV+ RED  LE A
Sbjct: 312 MQNARDALGNGAVGFGDHHLSVLVRETTLPRLDDASAACAAALADTGAVVVREDTNLEPA 371

Query: 363 WWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFN 422
           +WAQLPGN +Y  R   I+S N A+    H F +G+  GN WG AV LL+T + +P++FN
Sbjct: 372 FWAQLPGNEAYIVRRAMISSANMASFGSLHGFALGQAAGNHWGDAVTLLETTSATPFFFN 431

Query: 423 FHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPL 482
           FH GDLGN  V GPSGSGKTV++NFL AQ QK  P  + FDKD+GAE+FVR  GG+Y  +
Sbjct: 432 FHNGDLGNFSVIGPSGSGKTVVMNFLAAQAQKFAPRTILFDKDRGAELFVRGIGGRYDRI 491

Query: 483 KNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHA 542
             G+PTG  PL  +  +  N+ FLR W+  L+  EG     +E Q IA A+++      +
Sbjct: 492 YAGEPTGFNPL-ALPDSAANRAFLRDWLGVLLKAEG----PEELQTIAHAVDAAYENDAS 546

Query: 543 QRSLGALQLFFDNTSKE---GIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDF 599
            R L   +     + +     +  RL  WI   +  W+FDN +D+L+LD++ +G+DMT  
Sbjct: 547 LRQLRNFRELLSGSRRPEPGDLPDRLSAWIHSGEHAWLFDNQRDELDLDNRTLGFDMTAL 606

Query: 600 LDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGM 659
           L+N ++R P MMYLF+RI + +DG   +I+IDE WKAL+D+ F A  +D LKT+RK+N +
Sbjct: 607 LENPKLRTPTMMYLFHRIEERLDGNPAMILIDEGWKALDDEVFAARIRDWLKTLRKRNAL 666

Query: 660 MLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSR 719
           + FATQS  DAL S I+  ++EQ  T +F PN +A  +DY + F LT  E  LI+S L  
Sbjct: 667 VGFATQSAADALESRISTALVEQTATMVFMPNSRARAEDYCDGFGLTSHELALIRS-LPA 725

Query: 720 ESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLP 775
            SR FL++Q   SVV  L+L    + + +LSG   ++  ++ +    G +P  W P
Sbjct: 726 HSRCFLVRQPDASVVVRLDLSNAPEVLTVLSGRESSVRRLDLLREAVGDNPADWFP 781
>erg:ERGA_CDS_05400 virB4; VIRB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 801

 Score =  486 bits (1252), Expect = e-136
 Identities = 279/786 (35%), Positives = 439/786 (55%), Gaps = 11/786 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           I+ RE     +IPY  H N   +      ++ V+ + G  F+TAD   L+  ++  N +L
Sbjct: 15  IIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQML 74

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+I+     LY HIIRRR   + E     +  SSFA  ++ K+++K  +++ + NDL+++
Sbjct: 75  RSISSSSFGLYFHIIRRRRNAFTEGFASDKVSSSFANYVNVKWREKHATKQSFTNDLYIT 134

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSE-PDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++        E L+S   +  K    ++   D+ AI + ++E++  +   L +Y  ++L 
Sbjct: 135 IVREGGKKGMEFLSSILDKFGKGAAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILG 194

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +   +  +FSE  EFL Q+V  G  +      G ++  +   R+ FG + I+I   +  +
Sbjct: 195 IRETKHGVFSEIMEFLLQIVNCGSFQYALFPLGDVSRYLPMHRLYFGHKTIQIVGHNECK 254

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+E I+TQSF F ++ +A   M  +QN+MI ++D+
Sbjct: 255 YAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDK 314

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQ+  + +ALDD  S R   G+HHL++       KTL   LS   + L+N G    RE
Sbjct: 315 AVSQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVRE 374

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNF Y  R   I++ N A  +  H++P+GK   N WG AV +  T +
Sbjct: 375 KINLEPAFWAQLPGNFEYVVRKAIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTS 434

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++FNFH  D+G+T + GP+G GKTV++NFL AQ  K +P + FFDKD GAEIF+RA 
Sbjct: 435 GTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRAI 494

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++    TG  PL  ++ T  N+ FL  W+  L++     +T ++   I  AI  
Sbjct: 495 DGVYMVIEPRHLTGFNPLH-LDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEG 553

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGY 594
              L    R L  L  F        +A  +  W        +FDN +D L+ + S+  G+
Sbjct: 554 NFKLKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGF 613

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M+  L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK +R
Sbjct: 614 EMSHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLR 673

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ LI+
Sbjct: 674 KLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SAYRNVFMLTEREYTLIK 732

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG ++V+A +NL G+ D I++LSG T+ + +++ +I + G DP+ WL
Sbjct: 733 -HTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWL 791

Query: 775 PIFHQR 780
           PIF++R
Sbjct: 792 PIFYER 797
>erw:ERWE_CDS_05510 virB4; VIRB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 801

 Score =  486 bits (1252), Expect = e-136
 Identities = 279/786 (35%), Positives = 439/786 (55%), Gaps = 11/786 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           I+ RE     +IPY  H N   +      ++ V+ + G  F+TAD   L+  ++  N +L
Sbjct: 15  IIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQML 74

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+I+     LY HIIRRR   + E     +  SSFA  ++ K+++K  +++ + NDL+++
Sbjct: 75  RSISSSSFGLYFHIIRRRRNAFTEGFASDKVSSSFANYVNVKWREKHATKQSFTNDLYIT 134

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSE-PDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++        E L+S   +  K    ++   D+ AI + ++E++  +   L +Y  ++L 
Sbjct: 135 IVREGGKKGMEFLSSILDKFGKGAAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILG 194

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +   +  +FSE  EFL Q+V  G  +      G ++  +   R+ FG + I+I   +  +
Sbjct: 195 IRETKHGVFSEIMEFLLQIVNCGSFQYALFPMGDVSRYLPMHRLYFGHKTIQIVGHNECK 254

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+E I+TQSF F ++ +A   M  +QN+MI ++D+
Sbjct: 255 YAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDK 314

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQ+  + +ALDD  S R   G+HHL++       KTL   LS   + L+N G    RE
Sbjct: 315 AVSQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVRE 374

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNF Y  R   I++ N A  +  H++P+GK   N WG AV +  T +
Sbjct: 375 KINLEPAFWAQLPGNFEYVVRKAIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTS 434

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++FNFH  D+G+T + GP+G GKTV++NFL AQ  K +P + FFDKD GAEIF+RA 
Sbjct: 435 GTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRAI 494

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++    TG  PL  ++ T  N+ FL  W+  L++     +T ++   I  AI  
Sbjct: 495 DGVYMVIEPRHLTGFNPLH-LDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEG 553

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGY 594
              L    R L  L  F        +A  +  W        +FDN +D L+ + S+  G+
Sbjct: 554 NFKLKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGF 613

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M+  L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK +R
Sbjct: 614 EMSHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLR 673

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ LI+
Sbjct: 674 KLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SAYRNVFMLTEREYTLIK 732

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG ++V+A +NL G+ D I++LSG T+ + +++ +I + G DP+ WL
Sbjct: 733 -HTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWL 791

Query: 775 PIFHQR 780
           PIF++R
Sbjct: 792 PIFYER 797
>eru:Erum5250 virB4; type IV secretion system protein VirB4; K03199 type IV
           secretion system protein VirB4
          Length = 800

 Score =  486 bits (1252), Expect = e-136
 Identities = 279/786 (35%), Positives = 439/786 (55%), Gaps = 11/786 (1%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           I+ RE     +IPY  H N   +      ++ V+ + G  F+TAD   L+  ++  N +L
Sbjct: 14  IIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQML 73

Query: 63  RNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
           R+I+     LY HIIRRR   + E     +  SSFA  ++ K+++K  +++ + NDL+++
Sbjct: 74  RSISSSSFGLYFHIIRRRRNAFTEGFASDKVSSSFANYVNVKWREKHATKQSFTNDLYIT 133

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSE-PDMEAIRK-IEELSQDLIQGLESYEARLLS 176
           ++        E L+S   +  K    ++   D+ AI + ++E++  +   L +Y  ++L 
Sbjct: 134 IVREGGKKGMEFLSSILDKFGKGAAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILG 193

Query: 177 VYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER 235
           +   +  +FSE  EFL Q+V  G  +      G ++  +   R+ FG + I+I   +  +
Sbjct: 194 IRETKHGVFSEIMEFLLQIVNCGSFQYALFPMGDVSRYLPMHRLYFGHKTIQIVGHNECK 253

Query: 236 FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR 295
           + G+   KEY   T  GM D  L  P+E I+TQSF F ++ +A   M  +QN+MI ++D+
Sbjct: 254 YAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDK 313

Query: 296 ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARE 355
           A SQ+  + +ALDD  S R   G+HHL++       KTL   LS   + L+N G    RE
Sbjct: 314 AVSQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVRE 373

Query: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQA 415
            + LE A+WAQLPGNF Y  R   I++ N A  +  H++P+GK   N WG AV +  T +
Sbjct: 374 KINLEPAFWAQLPGNFEYVVRKAIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTS 433

Query: 416 GSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAG 475
           G+P++FNFH  D+G+T + GP+G GKTV++NFL AQ  K +P + FFDKD GAEIF+RA 
Sbjct: 434 GTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSPRIFFFDKDYGAEIFIRAI 493

Query: 476 GGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINS 535
            G Y  ++    TG  PL  ++ T  N+ FL  W+  L++     +T ++   I  AI  
Sbjct: 494 DGVYMVIEPRHLTGFNPLH-LDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEG 552

Query: 536 LESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGY 594
              L    R L  L  F        +A  +  W        +FDN +D L+ + S+  G+
Sbjct: 553 NFKLKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGF 612

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           +M+  L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK +R
Sbjct: 613 EMSHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLR 672

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           K N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ LI+
Sbjct: 673 KLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SAYRNVFMLTEREYTLIK 731

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
                 +R FL+KQG ++V+A +NL G+ D I++LSG T+ + +++ +I + G DP+ WL
Sbjct: 732 -HTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWL 790

Query: 775 PIFHQR 780
           PIF++R
Sbjct: 791 PIFYER 796
>net:Neut_2636 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 806

 Score =  485 bits (1249), Expect = e-135
 Identities = 296/783 (37%), Positives = 428/783 (54%), Gaps = 25/783 (3%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E  +P+   ++  +++  +   +    VEG++F+      + S    LN  +R +A  + 
Sbjct: 28  ERIVPFSSIIDDGIVSTKNGDYVRTWRVEGMSFEGLSEEEVYSRMEALNLFIRGLATGKY 87

Query: 71  ALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTS-GKTE 129
           A + H IRR  +   E   ++ F+  L  +Y +K+  Q +  ++ ++++++ P   G+  
Sbjct: 88  AFWVHRIRRYASDKLEVPEYNDFSQDLMGRYYEKLADQGMMSSEFYLTVVYRPFPLGR-- 145

Query: 130 QLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQS 189
                F +L +           A+ ++E +S+ ++  L  Y  + L  Y   G  FS Q 
Sbjct: 146 --GGVFGKLHRTVDEIKNEIAAAVERVEIVSKTVMSSLTKYRPQQLGNYVFAGRTFSCQL 203

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           EF   L+ G   RIP+    +   +   R++FG E+IE R      F      K+Y   T
Sbjct: 204 EFYSYLINGFWWRIPVKNLPLYKYLPVSRLLFGNEIIEYRDTFGSEFGAFLELKDYADYT 263

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
            PG+ + LL    E+I T SF   +   A+  + +++NQMI++ D A SQI  +DEA+D 
Sbjct: 264 TPGVLNTLLALDCEYIETHSFSPMTTLDAQSALKKQRNQMISSEDNALSQIVEIDEAIDS 323

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
           + S  FVLGE+H SL V  + P    E+ S A   L N   +    +    +A+ AQLP 
Sbjct: 324 VISGNFVLGEYHYSLLVKGETPDQTREFRSNASQLLNNANFLGVDLEKVTASAYAAQLPC 383

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFH----- 424
           N+  R R   I+SRNF  +  FH+F  GK  GN WG AV L +T AG+P+YFNFH     
Sbjct: 384 NWKSRPREARISSRNFTGVCSFHTFDSGKRNGNPWGEAVTLFRTPAGAPFYFNFHDTPLG 443

Query: 425 -----YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY 479
                   LGN  + G SG GKTV+  FL+  L K+    VFFDKD+GAEI +R  GGKY
Sbjct: 444 VDSTGNKALGNCQIIGQSGGGKTVLALFLMLNLLKYGTQCVFFDKDRGAEIAIRRVGGKY 503

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWV--LKLVTTEGQTV-TEQERQDIAKAINSL 536
             L+NG+PTG AP K ME TEKN +F   WV  +K  T       T +E   IA A+ S+
Sbjct: 504 LALENGKPTGFAPFK-METTEKNILF---WVALIKYCTRRSDVAHTPEEENLIASAVRSV 559

Query: 537 ESLPHAQRSLGALQLFFDNTSKEGIAIRLQRW-IKGNDLGWVFDNDQDDLNL-DSQFIGY 594
             +P  QR + A+  F       G+A RL++W I   +LGW  D  +D+L   + +  G+
Sbjct: 560 AGMPVQQRCIDAVLQFLPVGDPNGLAQRLKKWSISRGNLGWALDCQRDELQFEEGRPYGF 619

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIR 654
           D TDFLDNEEI  P+MMYL  R+ + IDGR     +DE+WKAL  D FK FA+++ KTIR
Sbjct: 620 DYTDFLDNEEICGPIMMYLMYRVEEQIDGRLFAFFMDEYWKALSVDYFKDFAKNKQKTIR 679

Query: 655 KQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQ 714
           KQNG+ ++ TQSP D L S IA  +IEQ  T IF PN  A++ DYV  FKLTE EF+L++
Sbjct: 680 KQNGLGVYMTQSPHDTLQSDIARALIEQTATFIFLPNPAADHDDYVNGFKLTETEFKLVR 739

Query: 715 SELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWL 774
            EL   SR FLIKQG    +A L+L    +EI ILSG+T  +E ++++ + YG DP  W 
Sbjct: 740 -ELQDSSRMFLIKQGHRVSLARLDLGDFKNEIKILSGSTDEVERLDRLRHKYGDDPAQWA 798

Query: 775 PIF 777
             F
Sbjct: 799 QPF 801
>wbm:Wbm0797 type IV secretory pathway, VirB4 components; K03199 type IV
           secretion system protein VirB4
          Length = 801

 Score =  481 bits (1239), Expect = e-134
 Identities = 285/791 (36%), Positives = 441/791 (55%), Gaps = 12/791 (1%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           SI+ RE    E+IPY  + N   +      L+  + + G  F+TAD   L   +N  N +
Sbjct: 13  SILSREVHAAEFIPYSCYWNSTTLITKQDWLVKFIKLSGFAFETADDEDLVIQNNIRNQM 72

Query: 62  LRNIADERVALYSHIIRRRETIYPES----RFFSSFAATLDEKYKKKMVSQELYRNDLFV 117
           LR+I+     LY H IRR++ I+ +      F + FA  ++ K+++K  +++ + NDL++
Sbjct: 73  LRSISSPAFGLYFHTIRRKKNIFSDEFASQNFPNFFANHVNLKWREKHATRQSFINDLYI 132

Query: 118 SLLWNPTSGKTEQLASFFQRLTKAKKTQS-EPDMEAIRK-IEELSQDLIQGLESYEARLL 175
           +++    +   E L+   ++        + E DM A  + +EE +  ++  L SY  ++L
Sbjct: 133 TIIRRADTKGVEFLSHLLKKFGHVTSKHAWESDMRATYEDLEETTNRVMTNLRSYSPKIL 192

Query: 176 SVYAHEGILFSEQSEFLHQLVG-GRRERIPLTFGT-IASTIYSDRVIFGKEMIEIRHESN 233
            V      LF E  EFL ++V  G      L   T I+  +   R+ FG++MI++   + 
Sbjct: 193 GVKETPNGLFCEIMEFLSRIVNCGFITNTLLPLKTEISRYLPVHRLFFGRKMIQVVTHNE 252

Query: 234 ERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAA 293
            ++ G+   KEY + T  GM D  L  P+EFI+TQSF F ++  A   M  +QN+MI +A
Sbjct: 253 SKYAGIVSIKEYGNNTSAGMLDHFLQLPYEFIITQSFQFTNRQMAIAKMQIQQNRMIQSA 312

Query: 294 DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIA 353
           D+A SQI  +  ALDD  S R V GEHHL++      PK+L   LS   + L+N G    
Sbjct: 313 DKAISQIAEISHALDDAMSGRIVFGEHHLTILCIEKSPKSLDNALSFVESELSNCGVYPI 372

Query: 354 REDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKT 413
           RE + LE A+WAQ+PGNF Y  R G I+S N A     H++P G    N WG AV +  T
Sbjct: 373 REKVNLEPAFWAQVPGNFDYIVRKGTISSLNLAGFVSQHNYPTGNKFNNHWGDAVTVFDT 432

Query: 414 QAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVR 473
            +G+P++FNFH  D+G+T + GP+G+GKTV++NFL AQ  K +P + FFDKD+GAEIF+R
Sbjct: 433 TSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSPRIFFFDKDRGAEIFLR 492

Query: 474 AGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAI 533
           A GG Y  ++    T   PL+ ++ T  N+ FL  W+  L++      T ++   +  AI
Sbjct: 493 ALGGIYTLIEPRTKTNFNPLQ-LDDTPDNRTFLMEWIKSLISVYNDKFTSEDITRVNDAI 551

Query: 534 NSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFI 592
                L    R L  L  F      + +A  +  W        +FDN +D L+   ++  
Sbjct: 552 EGNFKLRKEDRFLRNLVPFLGLAGSDTLAGAISMWHGNGSHAAIFDNKEDLLDFSKARVF 611

Query: 593 GYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKT 652
           G++M   L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D LK 
Sbjct: 612 GFEMASLLKDPIALGPVLIYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKV 671

Query: 653 IRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFEL 712
           +RK N  ++FATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F LTERE+ L
Sbjct: 672 LRKLNAFVVFATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-SIYRNVFMLTEREYIL 730

Query: 713 IQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDT 772
           I+      +R FL+KQG N+VVA ++L+G++D + +LSG  +++ L++ I+ + G DP  
Sbjct: 731 IK-HTDPSTRFFLVKQGINAVVARIDLKGLDDIVNVLSGRAESVILLHDILKEVGDDPKV 789

Query: 773 WLPIFHQRREN 783
           WLPIF+Q+ +N
Sbjct: 790 WLPIFYQKVKN 800
>wol:WD0858 virB4; type IV secretion system protein VirB4; K03199 type IV
           secretion system protein VirB4
          Length = 801

 Score =  476 bits (1224), Expect = e-132
 Identities = 281/794 (35%), Positives = 444/794 (55%), Gaps = 18/794 (2%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           S + RE    E+IPY  + N   +      L+ V+ + G  F+TAD   L   +N  N +
Sbjct: 13  STLNREVHAAEFIPYSCYWNSTTLMTKENWLVKVIKLSGFAFETADDEDLVIQNNIRNQM 72

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSS------FAATLDEKYKKKMVSQELYRNDL 115
           LR+I+    +LY H IRR++ I+ +   F+S      FA  ++ K+++K  +++ + NDL
Sbjct: 73  LRSISSPAFSLYFHTIRRKKNIFSDE--FASQGLPNFFANHVNLKWREKHATRQSFINDL 130

Query: 116 FVSLLWNPTSGKTEQLASFFQRLTKAKKTQS-EPDMEAIRK-IEELSQDLIQGLESYEAR 173
           +++++    +   E L+   ++        + E D+ A  + +EE +  ++  L +Y  +
Sbjct: 131 YITIIRRADTKGVEFLSHLLKKFGHVTSKHAWESDIRATYEDLEETTNRVVTSLRNYSPK 190

Query: 174 LLSVYAHEGILFSEQSEFLHQLVGG---RRERIPLTFGTIASTIYSDRVIFGKEMIEIRH 230
           +L V      LF E  EFL ++V          PL    I+  +   R+ FG++MI++  
Sbjct: 191 ILGVKETPDGLFCEIMEFLSRIVNCGFVTNTLFPLRT-EISRYLPVHRLFFGRKMIQVVT 249

Query: 231 ESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMI 290
            +  ++ G+   KEY + T  GM D  L  P+EFI+TQSF F ++  A   M  +QN+MI
Sbjct: 250 HNESKYAGIISIKEYGNHTSAGMLDSFLQLPYEFIITQSFQFINRQMAIGKMQIQQNRMI 309

Query: 291 NAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGA 350
            +AD+A SQI  + +ALDD  S +   G+HHL++      PK+L   LS   + L+N G 
Sbjct: 310 QSADKAISQIAEISQALDDAMSGKIAFGQHHLTILCIEKSPKSLDNALSLVESELSNCGV 369

Query: 351 VIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVAL 410
              RE + LE A+WAQ+PGNF Y  R   I+S N A  +  H++P G    N WG AV +
Sbjct: 370 YPIRERVNLEPAFWAQIPGNFDYIVRKATISSLNLAGFASQHNYPTGNKFNNHWGDAVTV 429

Query: 411 LKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEI 470
             T +G+P++FNFH  D+G+T + GP+G+GKTV++NFL AQ  K +P + FFDKD+GAEI
Sbjct: 430 FDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSPRIFFFDKDRGAEI 489

Query: 471 FVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIA 530
           F+RA  G Y  ++    T   PL+ ++ T  N+ FL  W+  L++      T ++   I 
Sbjct: 490 FLRALSGIYTVIEPRTKTNFNPLQ-LDDTSDNRTFLMEWIKSLISVYNDKFTSEDIARIN 548

Query: 531 KAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-S 589
            AI     L    R L  L  F      + +A  +  W        +FDN +D L+   +
Sbjct: 549 DAIEGNFKLRKEDRFLRNLVPFLGLAGPDTLAGAISMWHDNGSHAAIFDNKEDLLDFSRA 608

Query: 590 QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDR 649
           +  G++M   L +     P+++YLF+RI   +DG   IIV+DE W  +++  F    +D 
Sbjct: 609 RVFGFEMASLLKDPVALGPVLIYLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDW 668

Query: 650 LKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTERE 709
           LK +RK N  ++FATQS +DA  STI+ T+++Q  TQIF PN KA    Y + F LTERE
Sbjct: 669 LKVLRKLNAFVIFATQSVEDASKSTISDTLVQQTATQIFLPNLKAT-SVYRDVFMLTERE 727

Query: 710 FELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGAD 769
           + LI+      +R FL+KQG N+VVA ++L+G++D I +LSG  +++ L++ I+N+ G +
Sbjct: 728 YILIK-HTDPSTRFFLVKQGVNAVVARIDLKGLDDIINVLSGRAESVLLLHDILNEVGDN 786

Query: 770 PDTWLPIFHQRREN 783
           P  WLPIF+Q+ +N
Sbjct: 787 PKVWLPIFYQKVKN 800
>nse:NSE_0863 virB4-2; type IV secretion system protein VirB4
          Length = 803

 Score =  462 bits (1189), Expect = e-128
 Identities = 267/778 (34%), Positives = 426/778 (54%), Gaps = 15/778 (1%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQL-NTLLRNIADERVA 71
           ++PY  H++   I L    ++ V+ + G  F+TAD   ++ +H  L N L ++++    A
Sbjct: 24  FVPYKDHLDSSTILLKDNSMLKVIRLVGYPFETADDEDVD-IHKALRNQLFKSVSSGHFA 82

Query: 72  LYSHIIRRRETIYPESRFFSS----FAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGK 127
           L  H+IRRRE     + F +     FA  + +++++K  ++  + N+L+++++      K
Sbjct: 83  LSFHLIRRREGSQARALFSNKIPNYFADYVRKRWRQKHGNKSSFVNELYITVV-RRNDKK 141

Query: 128 TEQLASFFQRLTKAKKTQSE-PDME-AIRKIEELSQDLIQGLESYEARLLSVYAHEGILF 185
            E     ++++T+    +    D++ A  ++EE++  L+  L +    LL +     + +
Sbjct: 142 VELFNDLYRKVTRKDTKEGRIADLKIAHEELEEMTNKLLVSLRNNTPHLLGLKKVGNVTY 201

Query: 186 SEQSEFLHQLV--GGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWK 243
           SE   FL  +   G  +    L +G +   +   R+ FG++ IEI   S   + G+   K
Sbjct: 202 SEVLAFLSGIANCGVAQSDFVLPYGPLDEALCGCRMYFGRKSIEIVTPSRSEYAGIISLK 261

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           EY   T  GM D  L  P+E ++TQ+F F  +  A   M  +Q++M+   D+A SQ+  +
Sbjct: 262 EYGQNTSAGMLDNFLQVPYELVITQTFQFVHRQVAISKMQVQQSRMLQTQDKAISQVAEI 321

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
             ALDD  S R   G HHL++       K L   LS   + LTN G    RE + LE A+
Sbjct: 322 TRALDDAMSGRIAFGLHHLTILCREKTEKGLENALSLVESELTNAGVYAVREKINLEPAF 381

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
           WAQLPGNF Y  R   I++ N A  +  H++P GK+EGN WG A+ +  T +G+P+YFNF
Sbjct: 382 WAQLPGNFDYIVRKATISTLNLAGFASQHNYPFGKMEGNHWGDAITVFDTTSGTPFYFNF 441

Query: 424 HYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLK 483
           H  D+G+T + GP+G+GKTV++NFL AQ  K  P M FFDKD+GAEIF+RA GG Y  ++
Sbjct: 442 HCKDVGHTLIIGPTGAGKTVLLNFLCAQSMKFRPRMFFFDKDRGAEIFIRALGGIYTVIE 501

Query: 484 NGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQ 543
               +   PL+ ++ T +N+ FL  W+  L +  G   T  +   +  A+     L  A 
Sbjct: 502 PRSKSYFNPLQ-LDDTPENRTFLTEWLKILASVNGDKFTAADIATLNDAVAGNFKLDKAD 560

Query: 544 RSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-SQFIGYDMTDFLDN 602
           R+L  L  FF       +A RL  W        +FDN +D L+   +   G++M   L +
Sbjct: 561 RTLSNLSAFFGLEGDNSLATRLLMWYGNGSHATLFDNQEDCLDFSKASVFGFEMGHLLRD 620

Query: 603 EEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLF 662
                P++ YLF+RI   +DG   +IV+DE W  +++  F    +D LK +RK N  ++F
Sbjct: 621 SAALAPVLQYLFHRISISLDGSPSMIVLDEAWALIDNPVFAPTIKDWLKVLRKLNTFVIF 680

Query: 663 ATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESR 722
           ATQS +DA  S I+ T+++Q  TQIF PN KA    Y   F L+ERE+ LI+      +R
Sbjct: 681 ATQSVEDASKSAISDTLVQQTATQIFLPNLKAT-DVYRSVFMLSEREYMLIK-HTDPATR 738

Query: 723 RFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
            FLIKQ  ++V+A +NL GM D I++LSG    + L+++I+ +YG +P  WLP+F+++
Sbjct: 739 FFLIKQAMSAVIARINLSGMEDIISVLSGRADTVLLLHRIMEEYGEEPVKWLPVFYEK 796
>mes:Meso_4177 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 804

 Score =  451 bits (1161), Expect = e-125
 Identities = 278/785 (35%), Positives = 437/785 (55%), Gaps = 21/785 (2%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +RE     +IPY+R V   V+ L S  +++V+ ++G+ F T D   LN      NT++R 
Sbjct: 16  RRERPMSTHIPYLRQVADTVVGLESGAILSVIKLDGLFFQTEDQAELNMRAAVQNTMIRA 75

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPT 124
           +   R AL+S +IR+      E  F   F   L+ +Y   +  + ++ N+L+++++ +  
Sbjct: 76  LGSSRYALWSTVIRKEVRPSIEGSFSDPFCDLLNTRYMASLREKRMFTNELYLTIVRSGM 135

Query: 125 SGKTEQLASFFQRLTKAK--KTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
            G      SF + L ++   + Q +   E I ++EE+  ++ + L+ Y AR L +   +G
Sbjct: 136 RGALGAAESFSRLLDRSSGAEVQQQRLHERINELEEIVSNITRELQKYGARPLGIVHRDG 195

Query: 183 ILFSEQSEFLHQLVG---GRRERIPLTFGTIASTIYSDRVIFGKEMIEIRH--ESNERFV 237
             +SE   F + ++     R  R+P     I S + + R+ F K  ++ +   E+  RF 
Sbjct: 196 QPYSEPCAFFNTILTCGVSRDMRLPRM--GIGSYVGTSRLHFSKRTMQAQGPTEAETRFG 253

Query: 238 GMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRAS 297
            M   KEYP  + PGM DGLL    EFI TQSF    K  A+  + R Q Q I+A+D + 
Sbjct: 254 AMLSIKEYPPFSGPGMLDGLLQMNHEFICTQSFTLADKPIAQERISRLQRQ-IHASDESG 312

Query: 298 SQIDA-LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIARED 356
           S ++  +D AL+ L +   V G HH SL   +     L + +++  + LT+      RED
Sbjct: 313 STVETDIDFALNSLLNQEAVFGYHHFSLLCLSRDLAGLDKAVAELGSCLTDMNINWLRED 372

Query: 357 LGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAG 416
           L +EA++WAQLPGN +Y ARS  ++S NF+  S  H+F  G+  G  WG  +++L+T + 
Sbjct: 373 LNMEASFWAQLPGNHAYIARSCMLSSANFSGFSSLHNFATGRARGVHWGLPISILETTSQ 432

Query: 417 SPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTMVFFDKDQGAEIFVRA 474
           +PY+FNFH  D+G+  V GP+GSGKTV + FLLAQ  +    P  VFFDKD+GAEIF+RA
Sbjct: 433 TPYWFNFHQRDIGHFLVTGPTGSGKTVALTFLLAQAFRISPEPRAVFFDKDRGAEIFIRA 492

Query: 475 GGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFL-RSWVLKLVTTEGQTVTEQERQDIAKAI 533
            GG Y+ L+ G  TG  PL+ ME T  N+ FL R     L   +G+  +++E   + +AI
Sbjct: 493 VGGDYEVLQPGVATGFNPLQ-MENTASNREFLHRLLKAMLDPADGRGFSQEEEDTLERAI 551

Query: 534 NSLESLPHAQRSLGALQLFFDNTSK---EGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQ 590
             +   P  QR+L  L       ++     +  RL+ W +  +  W+F+  +D L+   +
Sbjct: 552 GRICQEPIEQRTLANLSGLLMGRARSDANDLQSRLRPWFE-REKAWLFNAPRDVLSFSGR 610

Query: 591 FI-GYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDR 649
            I G+DMT  LDN+++R P +MYL++R+ +L+ G  ++I +DE WK L+D  F  +  D+
Sbjct: 611 RIFGFDMTHILDNQDVRTPALMYLYHRLDELLTGEPVLIFMDEGWKLLQDPVFSNYIVDK 670

Query: 650 LKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTERE 709
           +KTIRK NG++ F TQS  D   +  +HT+IEQ  T + FPN +A+ + Y+  F LT +E
Sbjct: 671 MKTIRKLNGIVGFGTQSAADIARAPQSHTLIEQSATNLHFPNPRADEESYIRRFGLTAKE 730

Query: 710 FELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGAD 769
           F  I++    E R FLIK G +SV+A L+L  M D + ++SG  + IE    +    G D
Sbjct: 731 FAFIRN-TPPERRTFLIKHGNDSVIARLDLSSMPDLVRVMSGRKETIEQCAALRARLGDD 789

Query: 770 PDTWL 774
           P  WL
Sbjct: 790 PANWL 794
>yps:pYptb0006 triC; TriC protein; K03199 type IV secretion system protein VirB4
          Length = 915

 Score =  390 bits (1003), Expect = e-107
 Identities = 259/819 (31%), Positives = 423/819 (51%), Gaps = 53/819 (6%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           M + +R +L ++ IPY  HV++++I   +  LM    V G  F+       N    QLNT
Sbjct: 103 MRLNERVTLTDK-IPYSSHVHEYIIKGKNSDLMASWEVGGSVFEFETDEQKNMKSAQLNT 161

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           L+++   E V  Y H  R       +    ++FA  + ++Y + M     YRN LF+++ 
Sbjct: 162 LIKSFEGEPVTFYIHNSRENYHDSFQQNSGNAFADEVAKRYYEGMEGDAFYRNRLFLTVC 221

Query: 121 WNPTS--GKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY 178
             P S  GK E+     + ++  +K +S     AI++++E+   L   L    A  L  +
Sbjct: 222 MMPPSTLGKAER-----KGMSAGQKQRSLDG--AIKRMQEIRATLNTALTPLHATPLGTF 274

Query: 179 AHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVG 238
             +G+++S Q  F H L+ G  ++I +T       + +  + F     +        F  
Sbjct: 275 EEDGVVYSSQLSFYHFLLTGIWQKIRVTRTPFYEVLGTADLFFSGASGQRNTIRGTEFFR 334

Query: 239 MFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASS 298
               K+Y  K+  G+ D LL AP  ++LTQS+   +K   +  +   + ++ +A D A S
Sbjct: 335 TLEIKDYSPKSVTGLLDVLLHAPCNYVLTQSYTCMAKDEGQEAIKTVEKRLSSAEDDAVS 394

Query: 299 QIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLG 358
           Q   L  A D L+S     G +H SL + A   + LV+  +     LTN G V     L 
Sbjct: 395 QQTDLLVARDLLQSGHIAFGLYHFSLLISAPTLEALVKDTNTLANGLTNAGIVSTLASLS 454

Query: 359 LEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSP 418
           L A ++AQ+PG ++ R R   ++S+NF  ++ FH+F  GK +   WG AVA++KT +G  
Sbjct: 455 LAAGYFAQMPGVYTLRPRLVPVSSQNFVEMASFHNFSEGKRDRVPWGEAVAVVKTPSGGA 514

Query: 419 YYFNFHYGDLG----------NTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF------- 461
           +Y N H   LG          N  + G  GSGKT+++++L   +QK+     F       
Sbjct: 515 HYLNIHNTLLGKDDFNEKNAGNASIVGTIGSGKTMLISWLANMMQKYRQQSSFSPHAKKK 574

Query: 462 ------FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVT 515
                  DKD+G E+ +R  GG+Y  +K+G+PTG  P + ++ T++N  F++  +  L T
Sbjct: 575 RLCTVVLDKDRGTELNIRQLGGRYFRVKSGEPTGWNPFR-LKPTKRNIDFIKKLMKLLCT 633

Query: 516 TEGQTVTEQERQDIAKAINSLE-SLPHAQRSLGALQLFFDNTS-------KEGIAIRLQR 567
             G T++ ++   ++ A++++   L HA R  G  ++  + T        + G+ IRL +
Sbjct: 634 RNGNTLSTRQETRLSDAVDAVMLGLDHASRDHGITRVLENITEPATMEAQENGLKIRLAQ 693

Query: 568 WIKGNDLGWVFDNDQDDLNL-DSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRI 626
           W KG + GWVFDN++D  ++ +    G D T+FLD+ ++  P+  YL  RI  L+DGRR+
Sbjct: 694 WAKGGEFGWVFDNEEDTFDISECDIFGIDGTEFLDDSDVCAPISFYLLYRITSLLDGRRL 753

Query: 627 IIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQ 686
           ++ IDE WK L D +FK    + LKTIRK NG+++ ATQSP D L S+I+  ++EQC TQ
Sbjct: 754 VLFIDEVWKWLNDPAFKKLMFNLLKTIRKLNGLVIPATQSPSDLLKSSISTAMVEQCGTQ 813

Query: 687 IFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFL-----IKQGQN---SVVAELN 738
            F PN  A YKDYVE  K+    FE+I+  L   SR+F+     +++G     +V+  L+
Sbjct: 814 FFLPNPMAEYKDYVEGLKVPPAVFEVIKG-LDPLSRQFVLIKSPLRKGDTERFAVLVTLD 872

Query: 739 LRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
           L G+     ILSG+  N+ + + I  + G  P+ W   F
Sbjct: 873 LSGLGKYTKILSGSEDNLAIFDSIFTE-GMAPEEWRDTF 910
>ypm:YP_pCRY09 virB4; type IV secretory pathway VirB4 component; K03199 type IV
           secretion system protein VirB4
          Length = 894

 Score =  384 bits (987), Expect = e-105
 Identities = 252/813 (30%), Positives = 407/813 (50%), Gaps = 63/813 (7%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           ++YIPY  H++QHV+      L     + G  FD      L    NQL+ L+R+     V
Sbjct: 94  KKYIPYSSHIHQHVVRSPKSDLYCTWELMGTPFDCESDESLQFGTNQLHGLIRSFEGMPV 153

Query: 71  ALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQ 130
             Y H  R   T        + +A  +   Y   + S    RN LF+++ + P       
Sbjct: 154 TFYIHNDRNTFTDNLHQDSGNPYADEVSRLYYASVGS--FRRNRLFLTVCYRP------- 204

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIE-------ELSQDLIQGLESYEARLLSVYAHEGI 183
               F  L KA++ + + D + +++++       E+   L   L  Y AR L  +    +
Sbjct: 205 ----FVSLEKAERKRMK-DRQKLKELDGALLEMLEIKSTLDTALARYGARSLGTFTEGNM 259

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWK 243
           +FS Q  F   L+  +  ++ +T       + +  + F  E  +I H +  ++      K
Sbjct: 260 VFSSQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEIK 319

Query: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303
           E+  +T  GM D LL AP ++++TQS+   S+  A+  + R +  +++A D A SQ   L
Sbjct: 320 EFSEETATGMMDSLLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDL 379

Query: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363
           D ALD L S +   G+HH S+ V++   ++LV   ++    L N G      ++ L AA+
Sbjct: 380 DVALDLLTSGKIAYGKHHFSIMVYSPSLESLVADTNEISNALNNIGITPVPAEISLSAAY 439

Query: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423
            AQLPGN++ R R G ++S+NF  L+  H+F  GK +   WG A+AL++T +G  YY N 
Sbjct: 440 MAQLPGNYNLRPRKGELSSQNFVELAALHNFYPGKRDKAPWGYAMALMRTPSGDGYYINL 499

Query: 424 H----------YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNP-------------TMV 460
           H            +  +T + G +GSGKT+++ F     QK+               T V
Sbjct: 500 HNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYGREDSFSPDAKTKRLTTV 559

Query: 461 FFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQT 520
           + DKD+GAEI +RA GG+Y  + +G+PTG  P   +  T++N  F++  V  L T  G T
Sbjct: 560 YLDKDRGAEINIRALGGRYYRVISGEPTGWNPF-SLPATKRNINFIKQLVKILCTRNGAT 618

Query: 521 VTEQERQDIAKAINSLESLPHAQRSLGALQL-------FFDNTSKEGIAIRLQRWIKGND 573
           +T ++ + +  A+N++ S     R  G  +L             + G+ IRL +W +G +
Sbjct: 619 ITPRDERRLNDAVNAVMSDEPEYRRFGITRLREQLPEPATKEAQENGLDIRLSQWAQGGE 678

Query: 574 LGWVFDNDQDDLNLDS-QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDE 632
            GWVFDN+ D  ++ +    G D T+FLD+  +  P+  YL  RI  L+DGRR++I +DE
Sbjct: 679 FGWVFDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDE 738

Query: 633 FWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQ 692
           FWK L D  FK FA ++LKTIRK NGM++  TQSP + +   IA  +IEQC TQI   N 
Sbjct: 739 FWKWLRDPVFKDFAYNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANP 798

Query: 693 KANYKDYVEDFKLTEREFELIQSELSRESRRFLI-----KQGQNSVVA---ELNLRGMND 744
            A+   YV+  K     F++++  L  ++R++++     K+G     A    L+L G+  
Sbjct: 799 NADRAHYVDGMKFEPEVFDVVKG-LDPQARQYVVVKNQFKRGDTKRFAARVTLDLSGIGR 857

Query: 745 EIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
              ++SG   N+E+   I  + G  P  WL  +
Sbjct: 858 YTKVMSGDAPNLEIFESIYRE-GMQPHEWLDTY 889
>eca:ECA1620 virB4; putative conjugal transfer protein; K03199 type IV secretion
           system protein VirB4
          Length = 915

 Score =  374 bits (961), Expect = e-102
 Identities = 253/826 (30%), Positives = 422/826 (51%), Gaps = 67/826 (8%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           M + +R +L +++IPY  HV+  VI      L++   + G  F+  D +HL  +   LN 
Sbjct: 103 MKLNERVTL-DKHIPYSSHVHPQVIRNRHGDLVSTWELGGTVFECEDEHHLTLMATHLNN 161

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSS---FAATLDEKYKKKMVSQELYRNDLFV 117
           ++R+     +  Y H IR +   Y ++   SS   F+  +   Y + +  + L+R+ LF 
Sbjct: 162 VIRSYEGLPITFYLHRIREK---YQDAFAASSGIPFSDDVTALYYQPIKEKPLWRHRLFF 218

Query: 118 SLLWNPTSGKTEQLASFFQRLTKAKKTQSEPDME-------AIRKIEELSQDLIQGLESY 170
           +L + P           F RL K K  +++P  +       A++ + E    L   L  Y
Sbjct: 219 TLCYAP-----------FSRLEK-KAMKAQPSGKRTAALDGALKVMLEHRAALASALSRY 266

Query: 171 EARLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRH 230
            A  L VY   G ++S Q  F H+L+ G+ +++ +T       + +  V F  +  E + 
Sbjct: 267 TATPLGVYEENGRVYSSQLSFYHRLLTGQWQKVAVTRSPFYDILSTPDVFFTTDTAECQT 326

Query: 231 ESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMI 290
            S  RF      K+Y   T  G+ D LL A  E+++TQSF   ++  A+  +   + ++ 
Sbjct: 327 VSGSRFFRSLEIKDYSPDTATGLLDALLYAESEYVMTQSFTCMARDEAQNHIRLAEKRLN 386

Query: 291 NAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGA 350
           +AAD A SQ + L    D L+S     G++H SL V +D    +V+ ++       + G 
Sbjct: 387 SAADDAISQREELIVLRDLLQSGHVSCGKYHFSLLVSSDSADQVVKDVNALAQPFADLGI 446

Query: 351 VIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVAL 410
           +     L L AA+ AQLPG ++ R R  A++S+NFA ++  H+F   K  GN WG A+ +
Sbjct: 447 MTTLSTLSLPAAYLAQLPGVYTLRPRLVAVSSQNFADMASLHNFHPHKRNGNPWGEAITI 506

Query: 411 LKTQAGSPYYFNFHYGDL----------GNTFVCGPSGSGKTVIVNFLLAQLQKH-NP-- 457
           + +  G  YY N H              GNT + G +GSGKT+++  +   +QK+ NP  
Sbjct: 507 MTSPGGGGYYLNLHDSQAGRDDFNEKTPGNTAIIGKTGSGKTMLMTVMQQLMQKYRNPAT 566

Query: 458 ----------TMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLR 507
                     + V+FDKD+ AE+ +R  GG+Y  L+ G PTG  P   +  T++N  F++
Sbjct: 567 FSESAPHKRLSTVYFDKDRAAEMAIRQMGGRYFRLRTGVPTGFNPF-ALAPTKRNISFIK 625

Query: 508 SWVLKLVTTEGQTVTEQERQDIAKAINSLE-SLPHAQRSLG---ALQLFFDNTSKE---- 559
             V  L     + +  ++ + I+ A++++    P   R  G    L++  +  +KE    
Sbjct: 626 RLVRMLCRRNSKPLDPRDEERISTAVDTIMLDYPPEYRRYGITRLLEVLPEPPTKEARTN 685

Query: 560 GIAIRLQRWIKGNDLGWVFDNDQDDLNL-DSQFIGYDMTDFLDNEEIRRPLMMYLFNRIL 618
           G+ IRL++W +G + GWVFDN+ D  ++ D   +G D T+FLD+++IR P+  YL  R+ 
Sbjct: 686 GLRIRLKQWAQGGEFGWVFDNETDTFDISDIDNVGIDGTEFLDDDDIRGPITFYLLYRVT 745

Query: 619 DLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHT 678
            L+DGRR+++ +DEFWK L D  F  F+ + LK IRK NG+ + ATQSP + +   IA  
Sbjct: 746 GLLDGRRLVMFMDEFWKWLADVEFSRFSLNMLKVIRKLNGIFIPATQSPDEIVRHPIAPA 805

Query: 679 IIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNS------ 732
           IIEQC TQIF  N KA+  DYVE  K+ +  +++++     E    ++K    +      
Sbjct: 806 IIEQCGTQIFLANPKASRADYVEKMKVPDSVYDIVRHLDPGERYMVVLKTPLRAGETRPF 865

Query: 733 -VVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
             +A+++L G+     +LSG+  N++L + +  + G  PD W   F
Sbjct: 866 VSMAKMDLSGLGKITRMLSGSEDNLKLFDALYQE-GMQPDDWKDAF 910
>lpf:lpl0153 lvhB4; Legionella vir homologue protein; K03199 type IV secretion
           system protein VirB4
          Length = 826

 Score =  354 bits (908), Expect = 5e-96
 Identities = 251/809 (31%), Positives = 408/809 (50%), Gaps = 65/809 (8%)

Query: 27  LNSRCLM--------TVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIR 78
           LNS C+         +V+ V G  F+  +   LN     L+  L ++ D R  +Y    R
Sbjct: 25  LNSPCIFESQSGLVGSVIKVNGAAFEIEEAETLNHQRFLLHQALVSL-DSRFIIYVTTHR 83

Query: 79  RRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSL-LWNPTSGKTEQLASFFQR 137
           ++ +      F   FA  LDE+Y+++   + LY+N L++++ L    + KT     + + 
Sbjct: 84  QKISCPLIGEFKPGFAKDLDERYQQRFKDKNLYKNTLYITVVLKGDDTSKTGSWLKWAKS 143

Query: 138 LT-KAKKTQSEPDME-AIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQL 195
           L+ K     SE   E +I+ +  + + L   L  +EA +L     E + FSE  +FL  +
Sbjct: 144 LSIKGNSELSEHHREQSIQTLNRVVEQLQANLNPFEATILGKQ-DEVLGFSELLQFLGLV 202

Query: 196 VGGRR--------------ERIPLTF--------GTIASTIYSDRVIFGKEMIEIRHESN 233
           V   +                IP TF        G +   + S +++FG E I+ +  + 
Sbjct: 203 VNAGQTTSFKHPVCSPPIANSIPQTFKQEVKYPEGHLGQYLSSCQLLFG-ECIQFQGNTQ 261

Query: 234 ER--FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMIN 291
           +   F  M   K+YP+ T   + D +L+   EFI T +F    + +A   + +K++++++
Sbjct: 262 KDCVFGAMLSLKKYPTNTASILLDSMLSLDCEFIATHTFAPIGRDSALDTISKKRSKLLS 321

Query: 292 AADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV 351
           A D+A SQ  AL +  D + S   +LG HH ++ + A     L   + +A     + G V
Sbjct: 322 AEDKALSQTTALSDLEDGIASETLLLGAHHHTVMLLAPNKSLLDAAILEATKRYGSAGIV 381

Query: 352 IAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALL 411
           + +E LGLE A+W+QLP N  +  R+  ITS+NF    P H+   G    N  G AV LL
Sbjct: 382 VVKETLGLEPAFWSQLPCNQHFITRASLITSQNFVDFCPLHNTQTGFSNENFLGGAVTLL 441

Query: 412 KTQAGSPYYFNFH------YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKD 465
           +T + +P YFN+H          G+  + G + +GKT +VNFL AQ+ +      F D+D
Sbjct: 442 ETPSKTPVYFNYHARGSKTNPSKGHAAIFGGNNAGKTTLVNFLDAQMGRFGGRSFFIDRD 501

Query: 466 QGAEIFVRA-GGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQ 524
           + ++I++ A G   Y  ++   P  + PL+ +  T +N+ FL+SW   LV  E + V   
Sbjct: 502 ESSKIYILASGNSSYLKIEPSNPIAMNPLQ-LPDTSENRSFLKSWFATLVQEESERVIP- 559

Query: 525 ERQDIAKAIN-----SLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGND------ 573
               IA+ IN     S E L    R+L  L  F            L+RW+K ND      
Sbjct: 560 --SPIAEIINDCIDYSFEQLAPEFRTLSHLSQFLPVDFPRW--PHLKRWLKRNDSRIDGE 615

Query: 574 LGWVFDNDQDDLNLDSQFIGYDMTDFLD--NEEIRRPLMMYLFNRILDLIDGRRIIIVID 631
             W+FDN  D LNLD   +G+D+T  +D  +  I  P+ +YL +R+   +DGR    +I 
Sbjct: 616 FHWLFDNQHDALNLDFDKVGFDVTYLMDQVHSVIATPVYLYLLHRMRQCLDGRLTSFIIA 675

Query: 632 EFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPN 691
           E W+      ++   ++ L TIRK+NG  +F TQSPK   +S I H +++   T I FPN
Sbjct: 676 EAWQLFASPFWEKALREWLPTIRKKNGHFIFDTQSPKTITDSPIKHIVLDNLATLIAFPN 735

Query: 692 QKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSG 751
             A+ + Y+E  KLTE +FE I+ E + ESR FL KQ   + + +L+L G++  I +LS 
Sbjct: 736 PLADKETYMEHLKLTEAQFEAIK-ENTPESRIFLYKQDHEAFLCKLDLSGLSQYIRVLSA 794

Query: 752 TTKNIELVNQIINDYGADPDTWLPIFHQR 780
            T++ +L++ I+ + G DP+ WLP+F++R
Sbjct: 795 NTQSAKLLDDIMQEVGHDPELWLPVFYER 823
>lpn:lpg1254 virB4; LvhB4; K03199 type IV secretion system protein VirB4
          Length = 826

 Score =  347 bits (889), Expect = 8e-94
 Identities = 248/812 (30%), Positives = 408/812 (50%), Gaps = 58/812 (7%)

Query: 17  IRHVNQ-HVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSH 75
           + H+N   +    S  + +V+ V G  F+  +   LN     L+  L ++ D R  +Y  
Sbjct: 22  VTHLNSPSIFESQSGLVGSVIKVNGAAFEIEEAETLNHQSFLLHQALVSL-DSRFIIYVT 80

Query: 76  IIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSL-LWNPTSGKTEQLASF 134
             R++ +      F   FA  LDE Y+++   + LY+N L++++ L    S KT     +
Sbjct: 81  THRQKISCPLIGEFKPGFAKDLDEHYQQRFKDKNLYKNTLYITIVLKGDDSSKTGSWLQW 140

Query: 135 FQRLT-KAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFL 192
            + L+ K     SE   E  I+ +  + + L   L  + A +L     E + FSE  +FL
Sbjct: 141 AKSLSMKGNSELSEHHREQNIQILNRVVEQLQANLNPFGATILGKQ-DEALGFSELLQFL 199

Query: 193 HQLVGGRR--------------ERIPLTF--------GTIASTIYSDRVIFGKEMIEIRH 230
             +V   +                IP +F        G +   + S +++FG E I+ + 
Sbjct: 200 GLVVNAGQTISFKHPVYSPPIANSIPQSFRQEAKYPEGHLGQYLSSCQLLFG-ECIQFQG 258

Query: 231 ESNER--FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ 288
            + +   F  M   K+YP+ T   + D +L+   EFI T +F    + +A  ++ +K+++
Sbjct: 259 NTQKDCVFGAMLSLKKYPTNTASILLDSMLSLDCEFIATHTFAPIGRDSALNMISKKRSK 318

Query: 289 MINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNG 348
           +++A D+A SQ  AL +  D + S   +LG HH ++ + A     L   + +A       
Sbjct: 319 LLSAEDKALSQTTALSDLEDGIASETLLLGAHHHTVMLLAPNKPLLDTAILEATKRYGAS 378

Query: 349 GAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAV 408
           G V+ +E LG E A+W+QLP N  +  R+  ITS+NF    P H+   G    N  G AV
Sbjct: 379 GIVVVKETLGQEPAFWSQLPCNQHFITRASLITSQNFVDFCPLHNTQTGFSNENFLGGAV 438

Query: 409 ALLKTQAGSPYYFNFH------YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFF 462
            LL+T + +P YFN+H          G+  + G + +GKT +VNFL AQ+ +      F 
Sbjct: 439 TLLETPSKTPVYFNYHARGSKTNPSKGHAAIFGGNNAGKTTLVNFLDAQMGRFGGRSFFI 498

Query: 463 DKDQGAEIFVRA-GGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTV 521
           D+D+ ++I+V A G   Y  ++   P  + PL+ +  T +N+ FL+ W+  LV  E + V
Sbjct: 499 DRDESSKIYVLASGNSSYIKIEPSNPIAMNPLQ-LPDTSENRSFLKLWLATLVQEESECV 557

Query: 522 TEQERQDIAKAIN-----SLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGND--- 573
              +   IA+ IN     S E L    R+L  L  F            L+RW+K ND   
Sbjct: 558 IPSQ---IAEIINDCIDYSFEQLAPEFRTLSHLSQFLPVDFPRW--PHLKRWLKQNDSRI 612

Query: 574 ---LGWVFDNDQDDLNLDSQFIGYDMTDFLD--NEEIRRPLMMYLFNRILDLIDGRRIII 628
                W+FDN  D LNLD   +G+D+T  +D  +  I  P+ +YL +R+   +DGR    
Sbjct: 613 DGEFHWLFDNPNDALNLDFDKVGFDVTYMMDQVHSVIATPVYLYLLHRMRQCLDGRLTSF 672

Query: 629 VIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIF 688
           +I E W+      ++   ++ L TIRK+NG  +F TQSPK   +S I H +++   T I 
Sbjct: 673 IIAEAWQLFASPFWEKALREWLPTIRKKNGHFIFDTQSPKTITDSPIKHIVLDNLATLIA 732

Query: 689 FPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAI 748
           FPN  A+ + Y+E  KLTE +FE I+ E + ESR FL KQ   + + +L+L G++  I +
Sbjct: 733 FPNPLADKETYMEHLKLTEAQFEAIK-ENTPESRIFLYKQDHKAFLCKLDLSGLSQYIRV 791

Query: 749 LSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           LS  T++++L++ I+ + G DP+ WLP+F++R
Sbjct: 792 LSANTQSVKLLDDIMQEVGHDPELWLPVFYER 823
>lpp:lpp0171 lvhB4; legionella vir homologue protein; K03199 type IV secretion
           system protein VirB4
          Length = 826

 Score =  345 bits (886), Expect = 2e-93
 Identities = 248/812 (30%), Positives = 404/812 (49%), Gaps = 65/812 (8%)

Query: 24  VIALNSRCLM--------TVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSH 75
           V  LNS C+         +V+ V G  F+  +   LN     L+  L ++ D R  +Y  
Sbjct: 22  VTHLNSPCIFESQSGLVGSVIKVNGAAFEIEEAETLNHQRFLLHQALVSL-DSRFIIYVT 80

Query: 76  IIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSL-LWNPTSGKTEQLASF 134
             R++ +      F   FA  LDE+Y+++   + LY+N L++++ L    + KT     +
Sbjct: 81  THRQKISCPLIGEFKPGFAKDLDERYQQRFKDKNLYKNTLYITVVLKGDDTSKTGSWLQW 140

Query: 135 FQRLT-KAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFL 192
            + L+ K     +E   E  I+ +    + L   L S+ A +L +   E + FSE  +FL
Sbjct: 141 AKSLSMKGNSELAEHHREQNIQILNRAVEQLHTNLNSFGASILGMQDEE-LGFSELLQFL 199

Query: 193 HQLVGGRR--------------ERIPLTF--------GTIASTIYSDRVIFGKEMIEIRH 230
             +V   +                IP TF        G +   + S +++FG E I+ + 
Sbjct: 200 GLVVNAGQTASFKHPVYSPPIANSIPQTFKQEAKYPEGHLGQYLSSCQLLFG-ECIQFQG 258

Query: 231 ESNER--FVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ 288
            + +   F  M   K+YP+ T   + D +L+   EFI T +F    + +A   + +K+++
Sbjct: 259 NTQQDCLFGAMLSLKKYPTNTASILLDSMLSLDCEFIATHTFAPIGRDSALDTISKKRSK 318

Query: 289 MINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNG 348
           ++NA D+A SQ  AL +  D + S   +LG HH ++ + A     L   + +A       
Sbjct: 319 LLNAEDKALSQTTALTDLEDGIASETLLLGAHHHTVMLLAPNKSLLDAAILEATKRYGAT 378

Query: 349 GAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAV 408
           G V+ +E LG E A+W+QLP N  +  R+  ITS+NF    P H+        N  G AV
Sbjct: 379 GVVVVKETLGQEPAFWSQLPCNQHFITRASLITSQNFVDFCPLHNTQTSFSNENFLGGAV 438

Query: 409 ALLKTQAGSPYYFNFH------YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFF 462
            LL+T + +P YFN+H          G+  + G + +GKT +VNFL AQ+ +      F 
Sbjct: 439 TLLETPSKTPVYFNYHARGSKTNPSKGHAAIFGGNNAGKTTLVNFLDAQMGRFGGRSFFI 498

Query: 463 DKDQGAEIFVRA-GGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTV 521
           D+D+ ++I++ A G   Y  ++   P  + PL+ +  T +N+ FL+SW   LV  + +  
Sbjct: 499 DRDESSKIYILASGNSSYIKIEPSNPIAMNPLQ-LPDTSENRSFLKSWFATLVQEDSERA 557

Query: 522 TEQERQDIAKAIN-----SLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGND--- 573
                  IA+ IN     S E L    R+L  L  F            L+RW+K ND   
Sbjct: 558 IP---SPIAEIINDCIDYSFEQLAPEFRTLSHLSQFLPVDFPRW--PHLKRWLKRNDSRI 612

Query: 574 ---LGWVFDNDQDDLNLDSQFIGYDMTDFLDNEE--IRRPLMMYLFNRILDLIDGRRIII 628
                W+FDN  D LNLD   +G+D+T  +D  +  I  P+ +YL +R+   +DGR    
Sbjct: 613 DGEFHWLFDNQHDALNLDFDKVGFDVTYLMDQVQSIIATPVYLYLLHRMRQCLDGRLTSF 672

Query: 629 VIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIF 688
           +I E W+      ++   ++ L TIRK+NG  +F TQSPK   +S I H +++   T I 
Sbjct: 673 IIAEAWQLFASPFWEKALREWLPTIRKKNGHFIFDTQSPKTITDSPIKHIVLDNLATLIA 732

Query: 689 FPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAI 748
           FPN  A+ + Y+E  KLTE +FE I+ E + ESR FL KQ   + + +L+L G++  I +
Sbjct: 733 FPNPLADKETYMEHLKLTEAQFEAIK-ENTPESRIFLYKQDHEAFLCKLDLSGLSQYIRV 791

Query: 749 LSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           LS  T++++L++ I+ + G DP+ WLP+F +R
Sbjct: 792 LSANTQSVKLLDDIMQEVGHDPELWLPVFFER 823
>xcv:XCVc0041 virB4; type IV secretion system protein VirB4; K03199 type IV
           secretion system protein VirB4
          Length = 877

 Score =  303 bits (777), Expect = 8e-81
 Identities = 233/856 (27%), Positives = 406/856 (47%), Gaps = 89/856 (10%)

Query: 6   RESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNI 65
           +E    + IPY  H +   +      L+ V+ ++G+ F++     +     + NT+LR+I
Sbjct: 16  KEMALSDMIPYTVHYDDESVITKDDGLVQVIKLDGLYFESLTAEQIKQFERRRNTVLRSI 75

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNP-T 124
           A+    +Y H+IRR+  +YP     + FA   ++ ++++   +  Y N++++S++ N   
Sbjct: 76  ANSDRGVYVHLIRRKVNLYPAGEGGTWFARRFNQAWRERYNKRSFYVNEIYISIVRNRFR 135

Query: 125 SGKTEQLASFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLL------- 175
            G    L   F  L+ +K T+ + +   E  + + E +  ++Q L  Y AR L       
Sbjct: 136 QGAPGILDRAFSLLSGSKVTKEDLESFEEQAKDVNEAANLVVQTLSGYGARKLRIQRRPE 195

Query: 176 --------------------------------SVYAHEGIL------FSEQSEFLHQLVG 197
                                            VY  + +L      F+E   FLH LV 
Sbjct: 196 FVLDRVSRADAQLAVERFKMSWQEFQRSHGHHDVYRRDEVLDYLGEDFTEIGGFLHYLVN 255

Query: 198 GRRERIPLTFGTIASTIYSDRVIFG--KEMIEIRHESNERFVGMFGWKEYPSKTRPGMTD 255
              ER+P+T   +  T+    + F     M+ +++ S  R   M    E+P++T   M D
Sbjct: 256 LEDERVPVTEMQLDRTLAVSSLDFKMLSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLD 315

Query: 256 GLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR---ASSQIDALDEALDDLES 312
             L  P E+I+TQSF F  + +A   M R++ + I   DR   A    D + + L DL  
Sbjct: 316 EFLKQPVEYIITQSFFFTDRISAEHDM-RQERRRIAVNDREGVAEEDKDEITKGLQDLTR 374

Query: 313 NRFVLGEHHLSLAV-------FAD----QPKTLVEY---LSKARAHLTNGGAVIAREDLG 358
            R V G HHL++ V       FAD    + +T+ +    +   +    N G    RE   
Sbjct: 375 GRSVNGLHHLTMLVHVPATTQFADPIENKRQTIADLDGAVGLLKKAFVNLGVKPVREWFA 434

Query: 359 LEAAWWAQLPGNFS-YRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGS 417
           +E  +WAQLPG    +  R G I S NFA  +  H+F +GK++GN+WG A+   +T++G+
Sbjct: 435 VETFFWAQLPGQAQHFMGRRGKIKSGNFAGFASLHNFAVGKIDGNLWGPAIMPFETESGT 494

Query: 418 PYYFNFHYG----DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVR 473
            YYFNFH        G+  +   +G GKT ++   +A   K  P + +FD  +GA++F+R
Sbjct: 495 AYYFNFHREMEGMVAGHLALTADTGGGKTTLLAAFIAMADKARPRVFWFDNREGAKVFMR 554

Query: 474 AGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAI 533
           A GG++  L     TG  P+K +  T +N+ +L   +  + T  G  +   +     KA+
Sbjct: 555 AMGGQHTTLTVQGNTGWNPMK-LPDTPENRAYLVELLTLMRTCYGGKLVPDDIDRFKKAV 613

Query: 534 NSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDL---GW-VFDNDQDDLNLDS 589
           +   +L +  R L  +   F    +  +A  ++ W   N +    W VFDN  D+++L  
Sbjct: 614 HENYALAYPDRRLRNVAWCF---GQGELAKDMRVWHGANGIEGANWGVFDNAHDNIDLTK 670

Query: 590 -QFIGYDMTDFLDNEEIRRPL---MMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAF 645
            +   Y+M   + +   R  L   + Y F+RI   ++G   I+V++E    ++   ++  
Sbjct: 671 CRHYCYEMRQLIKDGSARPELPVVLSYPFHRIEQSMNGEPFILVLEEGQNLVKHAYWREK 730

Query: 646 AQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKL 705
               +  IR++NG+++F T   K     T   +I +Q  T+I+ PN +AN  D V+   L
Sbjct: 731 IDSYIMQIRRKNGLLVFVTPDAKYLYCET--DSIQKQTATKIYLPNGEANRTDLVDVLGL 788

Query: 706 TEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIIND 765
           T  E+E ++ +   E+R FLI++G  S+ A+ +L  M   I +LS   K + L+++II +
Sbjct: 789 TPGEYEFVR-DTPPENRTFLIRRGNESIKAKFDLSDMPAFIPVLSSNDKGVALMDEIIRE 847

Query: 766 YGA-DPDTWLPIFHQR 780
               DP+ W+P+F +R
Sbjct: 848 LETDDPEQWVPVFMER 863
>xac:XACb0045 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 877

 Score =  301 bits (772), Expect = 3e-80
 Identities = 232/856 (27%), Positives = 409/856 (47%), Gaps = 89/856 (10%)

Query: 6   RESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNI 65
           +E    + IPY  H +   +      L+ V+ ++G+ F++     +     + NT+LR+I
Sbjct: 16  KEMALSDMIPYTVHYDDESVITKDDGLVQVIKLDGLYFESLTAEQIKQFERRRNTVLRSI 75

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNP-T 124
           A+    +Y H+IRR+  +YP     + FA   ++ ++++   +  Y N++++S++ N   
Sbjct: 76  ANSDRGVYVHLIRRKVNLYPAGEGGTWFARRFNQAWRERYNKRSFYVNEIYISIVRNRFR 135

Query: 125 SGKTEQLASFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLL------- 175
            G    L   F  ++ +K T+ + +   E  + + E +  ++Q L  Y AR L       
Sbjct: 136 QGAPGILDRAFSLVSGSKITKEDLESFEEQAKDVNEAANLVVQTLSGYGARKLRIQRRPE 195

Query: 176 --------------------------------SVYAHEGIL------FSEQSEFLHQLVG 197
                                            VY+ + +L      FSE   FLH LV 
Sbjct: 196 FVLDRVSRADAQVAVERFKMSWQEFQRSHGHHEVYSRDEVLDYLGEDFSEIGGFLHYLVN 255

Query: 198 GRRERIPLTFGTIASTIYSDRVIFG--KEMIEIRHESNERFVGMFGWKEYPSKTRPGMTD 255
              ER+P+T   +  T+    + F     M+ +++ S  R   M    E+P++T   M D
Sbjct: 256 LEDERVPVTEMQLDRTLAVSYLDFKMLSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLD 315

Query: 256 GLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADR---ASSQIDALDEALDDLES 312
             L  P E+I+TQSF F  + +A   M R++ + I   DR   A    D + + L DL  
Sbjct: 316 EFLKQPVEYIITQSFFFTDRISAEHDM-RQERRRIAVNDREGVAEEDKDEITKGLQDLTR 374

Query: 313 NRFVLGEHHLSLAV-------FAD----QPKTLVEY---LSKARAHLTNGGAVIAREDLG 358
            R V G HHL++ V       FAD    + +T+ +    +   +    N G    RE   
Sbjct: 375 GRSVNGLHHLTMLVHVPATTQFADPIENKRQTIADLDGAVGLLKKAFVNLGVKPVREWFA 434

Query: 359 LEAAWWAQLPGNFS-YRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGS 417
           +E  +WAQLPG    +  R G I S NFA  +  H+F +GK++GN+WG A+   +T++G+
Sbjct: 435 METFFWAQLPGQAQHFMGRRGKIKSGNFAGFASLHNFAVGKIDGNLWGPAIMPFETESGT 494

Query: 418 PYYFNFHYG----DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVR 473
            YYF+FH        G+T     +G+GKT ++  L+A   K  P + +FD  +GA++F+ 
Sbjct: 495 AYYFSFHREMEGMVAGHTAFTADTGAGKTTLLAALIAMGDKAYPRVFWFDNREGAKVFMC 554

Query: 474 AGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAI 533
           A GG++  L     TG  P+K +  T +N+ +L   +  + T  G  +   +     KA+
Sbjct: 555 AMGGQHTTLTVQGSTGWNPMK-LPDTPENRAYLVELLTLMRTCYGGKIVPDDIDRFKKAV 613

Query: 534 NSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDL---GW-VFDNDQDDLNL-D 588
           +   +L +  R L  +   F    +  +A  ++ W   N +    W VFDN+ D+++L +
Sbjct: 614 HENYALAYPDRRLLNVAWCF---GQGELAKDMRVWHGANGIEGANWGVFDNEHDNIDLTN 670

Query: 589 SQFIGYDMTDFLDNEEIRRPL---MMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAF 645
            +   Y+M   + +   R  L   + Y F+RI   ++G   I+V++E    ++   ++  
Sbjct: 671 CRHYCYEMRQLIKDGTARPELPVVLSYPFHRIEQSMNGEPFILVLEEGQNLVKHAYWREK 730

Query: 646 AQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKL 705
               +  IR++NG+++F T   K     T   +I +Q  T+I+ PN +A   D V+   L
Sbjct: 731 IDSYIMQIRRKNGLLVFVTPDAKYLYCET--DSIQKQTATKIYLPNGEAKRTDLVDVLGL 788

Query: 706 TEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIIND 765
           T  E+E ++ +   E+R FLI++G  S+ A+ +L  M + I +LS   K + L+ +II +
Sbjct: 789 TPAEYEFVR-DTPPENRTFLIRRGNESIKAKFDLSDMPEFIPVLSSNDKGVALMEEIIRE 847

Query: 766 YGA-DPDTWLPIFHQR 780
               DP+ W+P+F +R
Sbjct: 848 LETDDPEQWVPVFMER 863
>rde:RD1_A0014 virB4; VirB4 protein, putative
          Length = 786

 Score =  300 bits (769), Expect = 7e-80
 Identities = 224/764 (29%), Positives = 374/764 (48%), Gaps = 38/764 (4%)

Query: 7   ESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTA---DINHLNSLHNQLNTLLR 63
           E L   ++PY+  V   V+ L    L+    VEG+  DTA   D++ L+   ++  T  +
Sbjct: 21  EHLLVRHLPYVGAVTDDVMMLRDGDLIASFIVEGIAADTASEADVDDLSLAFSRTVTQAQ 80

Query: 64  NIADERVALYSHIIRRRET-IYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWN 122
           +     V  +S ++  + T + PE    S+FAA +D++++  + +  L      +++   
Sbjct: 81  SDVGIYVHRFSSVVSPKLTGVAPE---VSTFAAAVDQRWQSHIETSGLRSRQAMITVTLR 137

Query: 123 PTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
           P+  K+   A F      A++   E D   + ++ E+    ++ +       LS+ + E 
Sbjct: 138 PSKVKS-LWAKFVSGGVAAQRGTREKD---VSRLNEIVDHFMEAVRVASPTRLSISSGEW 193

Query: 183 ILFSEQSEFLHQLVGGRRERIP--LTFGTIASTIYSDRVIFGKE-MIEIRHESNE-RFVG 238
           I        L  +  G+    P    F  +A  I   R+ F  +  +    +S + R+  
Sbjct: 194 I------GLLRAINTGQFFTSPPGAGFMPLADMIAVGRLDFRNDTFVSFGSDSKDTRYGA 247

Query: 239 MFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASS 298
           +F  K YPS + PG+ +     PF+ +++QS+   +   +   + R   QM  A D A +
Sbjct: 248 VFSIKSYPSNSAPGIFNRF-DLPFDMVISQSYTPVNPVESEERISRTARQMQAADDAAQT 306

Query: 299 QIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLG 358
             D L +ALDD+ S R  +G HH ++ VFA     L E  +  R      GA + RED+G
Sbjct: 307 LKDQLVDALDDVASGRIGMGMHHATITVFAGTVAELDEAAASIRGAGQRAGATVVREDVG 366

Query: 359 LEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNV-WGAAVALLKTQAGS 417
             AA++AQ PGN++YRAR+  I+S NFA  +  H+ P G       WG +V +L    G 
Sbjct: 367 ARAAFFAQHPGNYAYRARAAMISSTNFADFTALHATPAGHSRAQTPWGESVTILPDIRGE 426

Query: 418 PYYFNFHY-GDL-----GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF 471
           PY FNFH  G+L     G+T V G +G+GKT+   FLLAQ  + NP ++ FDKDQG E+ 
Sbjct: 427 PYRFNFHLAGELQERTVGHTLVIGMTGAGKTLGACFLLAQAARLNPRIIAFDKDQGMEMP 486

Query: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAK 531
           +RA G  Y  ++ G+PTG  P    E  E+   +L SW+   +  +G T++  +R+ ++ 
Sbjct: 487 LRALGADYAKVRMGEPTGFNPF-AAEADERGTAWLTSWLEATLAAQG-TLSATQREALSN 544

Query: 532 AINSLESLPHAQRSLGALQLFFDNTSKEG-IAIRLQRWIKGNDLGWVFDNDQDD--LNLD 588
           A  S      + R++   +    +    G +  RL  W  G   GW+F  +  D  L+ +
Sbjct: 545 ATRSNMETDPSLRTMRQFRSQLRSVDDGGDLHTRLGLWDDG-QYGWLFSGEGQDETLSFN 603

Query: 589 SQFIGYDMTDFLDNEEIRRPLMMYLFNRI-LDLIDGRRIIIVIDEFWKALEDDSFKAFAQ 647
           +    +D+T+  + +E+R   + Y+F RI   + D R  II+IDE WK L+D  F+A  +
Sbjct: 604 NDVTAFDLTEIFETQEVRTAWLAYVFRRIERQIEDERPTIILIDEAWKVLDDPFFEAMLK 663

Query: 648 DRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTE 707
           D   T+RK+N +++  TQ     +NS    +I+E C T + +PN +    D V     T+
Sbjct: 664 DWALTLRKKNVVLMLMTQRVDHLVNSAAGGSILESCVTTLVYPNSRYTL-DEVAPLNFTD 722

Query: 708 REFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSG 751
            E   + S    + R  LI+ G  S V  ++L  +   + +L G
Sbjct: 723 AEAAFVTSSAGGQ-RLALIRNGDVSTVVNMDLGALGPLLKVLGG 765
>sit:TM1040_3819 CagE, TrbE, VirB component of type IV transporter system
          Length = 791

 Score =  279 bits (713), Expect = 2e-73
 Identities = 229/791 (28%), Positives = 362/791 (45%), Gaps = 48/791 (6%)

Query: 6   RESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNI 65
           RE+     +PY+  V+   +      L   +  +GVN  T D  +L+ +      ++  +
Sbjct: 23  RETRLAHMLPYVSLVDDQTVRTRVNELFQCIRFDGVNSYTTDDTYLDKVTALFARIIAQL 82

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTS 125
             E  + Y H + +      +     SFA  +D  ++KK+ +  L    L ++++  P  
Sbjct: 83  GPE-FSYYVHKVSKAIKPDLDPIRKDSFAGEVDRLWRKKLETSGLRDKTLTLTIIHRPPP 141

Query: 126 GKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILF 185
              + +  F  R   A     +   + +R++ E     + GL     R+LS    E I  
Sbjct: 142 ---KSVLPFLNR--SAPNRLKKATEKRLRRLGEAVNVFLSGLSELNPRILSAETGELI-- 194

Query: 186 SEQSEFLHQLVGGRRERIPL----TFGTIASTIYSDRVIFGKEMIEIRHES-NERFVGMF 240
                FL  L  G  + +PL    T+G ++    + RV F  +  E+       R+   F
Sbjct: 195 ----GFLGALNTG--QELPLYPANTYGFLSFNAANTRVTFQGDHFELSEGVVGHRYGKSF 248

Query: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300
              EY   T   M D +L  P + I+T SF   +       + R++ QM  + D A S +
Sbjct: 249 TIGEYSEGTSCTMFD-MLNLPVDMIVTHSFTPINSNLMAGRIKRQKRQMQASQDAALSLM 307

Query: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAV----IARED 356
           +ALD A DDLE+ R   GEHH+ + +F D     ++ L    A + N  A     +  E 
Sbjct: 308 EALDIAADDLEAKRQSFGEHHMVVTIFCDT----LDELQTLSAEIVNAAAAEGVKMIGER 363

Query: 357 LGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNV-WGAAVALLKTQA 415
           +  +A + +Q PGN   R R+ AIT+RNFA  + FH   +GK  G   WG  +  L T  
Sbjct: 364 VAAKAHYLSQHPGNQPKRVRASAITNRNFADFAAFHRTQLGKPAGKTPWGKVITYLPTPE 423

Query: 416 GSPYYFNFHYGDL-------GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGA 468
            S Y F++H           G+T + G  GSGK+V+  FL+ Q ++    +  FD   G 
Sbjct: 424 QSAYRFSYHEQGSPEKEPTSGHTLIMGRPGSGKSVLSAFLMTQARRAGARIFVFDYRLGM 483

Query: 469 EIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQD 528
           E+ VRA GG+Y  LK GQPTG+ PL   E   +   +L  W+  L+    + +T  +   
Sbjct: 484 EMAVRANGGRYASLKAGQPTGLNPL-WTETDARGTAWLSDWLATLLYRADKPLTPAQTNR 542

Query: 529 IAKAI--NSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDND-QDDL 585
           I + +  N+  + P  +       LF        +  RL  W +    GW+F    +D  
Sbjct: 543 IQEVVRQNAQATNPALRNWRDFASLFVSTDDGGDLHQRLLEWTEEGRYGWIFGQTLEDTF 602

Query: 586 NLDSQFIGYDMTDFLDN--EEIRRPLMMYLFNRILDLIDGRR-IIIVIDEFWKALEDDSF 642
           +L+   +G+D+T  LD+  E+ R  ++ YLF R+   I+ RR  IIVIDE WKAL++  F
Sbjct: 603 SLEGDVVGFDLTGILDSEAEKERMAVLSYLFRRVEREIEDRRPTIIVIDEAWKALDNAYF 662

Query: 643 KAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVED 702
                + L T RKQN + +  TQ       +    TI+E  PTQI  PN +A+  DY   
Sbjct: 663 AERLSNWLVTARKQNTVAVMMTQYASQLERTRTGKTIVEAVPTQILLPNIRAHAADYAM- 721

Query: 703 FKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQI 762
             L E+E +++ +  S +SR  LI+  Q S+V + +L  +   + IL G      LV   
Sbjct: 722 LNLYEKELDVLLNTGS-DSRLALIRDDQGSIVVDADLSALGPNLTILGGMETGEALVG-- 778

Query: 763 INDYGADPDTW 773
            +DY   PD W
Sbjct: 779 -SDYRNRPDFW 788
>rle:pRL70152 putative crown gall-like type IV secretion system protein
          Length = 793

 Score =  278 bits (711), Expect = 4e-73
 Identities = 220/756 (29%), Positives = 357/756 (47%), Gaps = 37/756 (4%)

Query: 14  IPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADER--VA 71
           +PY+  V+   + L    LM    VEG+N +T D  H   L N  +   R IA +R  VA
Sbjct: 35  LPYLSAVDDVTLMLRDGDLMGSFVVEGINAETVDSFHTVELCNAFS---RFIAQQRSDVA 91

Query: 72  LYSHII--RRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
            Y H I    R T+ P       F   +D +++  + +  L      V+L+  P    T+
Sbjct: 92  YYVHRISVETRPTMPPVGGH--PFNEEIDRRWQGYLQTVGLRDRVTVVTLVIRPPRKTTK 149

Query: 130 QLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQS 189
            L+ F  R   ++    E +  A+R  + ++  ++   E+  +RL        +      
Sbjct: 150 FLSLFGGRDVHSRH---EVEARALRLDQMINTCMVGVGEAGPSRLT-------VSDGRWL 199

Query: 190 EFLHQLVGGRR-ERIPLT-FGTIASTIYSDRVIFGKEMIEIR--HESNERFVGMFGWKEY 245
             L  L+ G     IP T F  +A  + S ++ F   + E      +  RF  +   K+Y
Sbjct: 200 GLLRTLIDGSGGSLIPGTKFLPVADLLASSQITFQGPVFECEGTDPARRRFGTIVSVKDY 259

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
           P++T PG+ D L   P+  ++TQSF      +A+  + R + QM  A D A S +  L+E
Sbjct: 260 PAETYPGILDRL-NLPYNTVVTQSFTPIDPISAQGKIARVRKQMRAAEDAAISLMAQLEE 318

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A DD+ S R + G+HH S+AVF D  K L   ++     + + GA I RE+      ++A
Sbjct: 319 AEDDVASGRVIFGDHHCSVAVFCDSLKELDGAMAYVTRAMQDAGAAIVRENFSSRVVYFA 378

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNV-WGAAVALLKTQAGSPYYFNFH 424
           Q PGNF+YR R   I+S+NFA L   H    G       WG AV +  T  G  + FNFH
Sbjct: 379 QHPGNFAYRTRPAMISSQNFAQLCAMHGQSKGSPPDKCPWGDAVTIFPTARGETFRFNFH 438

Query: 425 ------YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGK 478
                    +G+T V G +GSGKT+   FL++Q Q+     + FDKD G E+ VRA GG 
Sbjct: 439 LPGKPGQRTVGHTLVLGQTGSGKTLGTAFLISQAQRLGARTILFDKDNGFEMAVRAMGGC 498

Query: 479 YKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLES 538
           Y  ++ G  TG  P++  E   +   +L  W+  L   +G  +   + Q ++ A+ +  +
Sbjct: 499 YSAVRMGDETGFNPMRA-EADSRGAAWLMDWLAALAENDGGKLNPVQIQALSDAVQANTT 557

Query: 539 LPHAQRSLGALQLFFDNTSKEG-IAIRLQRWIKGNDLGWVF-DNDQDDLNLDSQFIGYDM 596
                ++L   +     T  +G +  RL RW +    GW+F     D L  D++   +D+
Sbjct: 558 ADPRLQNLEQFRSQLRATDDDGDLYNRLGRWDETGQFGWLFGGKGLDPLAFDNRLTAFDL 617

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLI-DGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRK 655
           T+  DN+ +R   + Y+F R+  L+ D    ++V+DE WK L++  F+A  +D + T+RK
Sbjct: 618 TEIFDNDVVRTAWLSYVFRRVERLVEDEHPTLLVLDEAWKLLDNPYFEARLKDWMLTMRK 677

Query: 656 QNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQS 715
           +N  ++  TQ      NS     I+E   T++ +     N    +    LT  E   +Q 
Sbjct: 678 KNVAVVLLTQRVSHIKNSAAGDAILESAVTRLVY-TSSFNTAAELAPLHLTPTESAFLQM 736

Query: 716 ELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSG 751
             + ++   L+K G +SVV + +L  +   I +L G
Sbjct: 737 S-NVDNHLVLLKSGSDSVVLDFDLVAIGKGIDVLGG 771
>wol:WD1173 type IV secretion system protein VirB4, putative; K03199 type IV
           secretion system protein VirB4
          Length = 788

 Score =  265 bits (677), Expect = 3e-69
 Identities = 192/784 (24%), Positives = 382/784 (48%), Gaps = 34/784 (4%)

Query: 7   ESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLN-TLLRNI 65
           ES+  +++PY  H ++  I      L+ ++ +E    D + +++ + L  ++  ++ +NI
Sbjct: 26  ESIDLDFVPYACHYDEETILTKQGELLKIIKLE----DYSSVDNYSDLRTEIRKSISKNI 81

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPT 124
                 ++ H +R+R  +  +      F+  L   +  K+   +L Y N+L++ +L++  
Sbjct: 82  NSLCFTVWIHTVRKRNKLSLKWNKTEDFSDNLHSTWFNKLTDSKLQYINELYIVILFSDF 141

Query: 125 SGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGIL 184
            GK    + FF R+    K   +   + ++KI ++ Q+    L  + A+ LS+   EG +
Sbjct: 142 -GKHTNNSFFFNRIKNKHKLSLQESHQELQKITDVIQN---DLGPFGAKKLSLRFSEGKI 197

Query: 185 FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKE 244
           +SE  EFLH +V    +  P+    ++  I + ++ FG    +   E+ ++F  +F  KE
Sbjct: 198 YSEMIEFLHYIVTLTHKDYPIHERDLSQYIRNFKIAFGFNTFQTIFENQQKFGSIFSIKE 257

Query: 245 YPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALD 304
           Y  +   G  D  L    EFI+T+  +F S   A     ++ N +  + D    +   ++
Sbjct: 258 Y-REISLGNIDRCLQLESEFIITEIMIFTSNNKAIKEFKKQINMLQISEDSTLLKSSGIE 316

Query: 305 EALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWW 364
           E ++  +++     +  +   +FAD    L E +S   + ++  G ++ R DL +E+ +W
Sbjct: 317 EIIELEKTSSIDFCQQKIIFTIFADDRNKLAESISDLSSIMSLVGFMMFRTDLHMESHFW 376

Query: 365 AQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFH 424
           AQLPGNF++  +   I ++   + +  H F  G L+G  W  AV +  ++ G+PY+FNFH
Sbjct: 377 AQLPGNFAFITQPKNILTKYACSFAMLHDFTSGTLKGRRWKEAVMIFFSKKGNPYFFNFH 436

Query: 425 -YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY---K 480
              + G+T + G   SG+T ++NFLL++ +K NP +V  D    + IF +A  GKY    
Sbjct: 437 GRRNNGHTTILGAPNSGRTSLINFLLSESRKFNPRIVILDNTGKSIIFTKAVSGKYYIID 496

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           P    +     PL  +E +  N+  L   + ++V        E++   I K ++S+ ++P
Sbjct: 497 PKYKDKSLKFNPL-NIEDSASNRNMLVELIRRMVADTSLVDVEEK---IRKIVDSIFAIP 552

Query: 541 HAQRSLGALQLFFDNTSKEGIAI---RLQRWIKGNDLGWVF-DNDQDDLNLDSQFIGYDM 596
              RS+  +         E + +   ++ RW    D  ++F D D+ D++ +++ I  + 
Sbjct: 553 KESRSISQI--------SEVLLLLGGKISRWCDDGDFAYLFQDGDESDIDWETKIISLNT 604

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQ 656
            +    +E    ++ Y         DG   I+V+DE W+       +    + ++ + + 
Sbjct: 605 ANLTKQKECMSVILYYFLYSFEAKCDGSPAILVLDEAWEISNIFPTEKEFDNWMQRMTEL 664

Query: 657 NGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSE 716
           N +++ +T++   A  S     + +   T+I  PN  AN + Y++ F L++ E  +I   
Sbjct: 665 NVVVILSTENLNLAFASKFTQYLDKHVDTRILMPNVNAN-RLYMKAFSLSKEELNIILQT 723

Query: 717 LSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPI 776
            ++E   FLIKQ +  V   L+L+ M  EI +LS   + I+ + + I + G + + WLP+
Sbjct: 724 PTQEG-LFLIKQYKGLVTLNLDLKDM-QEIHVLSANKETIKYMYEAIKEKGEEVNEWLPV 781

Query: 777 FHQR 780
           F+++
Sbjct: 782 FYEK 785
>hpj:jhp0492 cagE; DNA transfer protein (Agrobacterium VirB4 homolog); K03199
           type IV secretion system protein VirB4
          Length = 983

 Score =  248 bits (634), Expect = 3e-64
 Identities = 225/813 (27%), Positives = 355/813 (43%), Gaps = 93/813 (11%)

Query: 24  VIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRRETI 83
           VI  N+  L+  + + G++F T     L  LH  + ++ RN        Y H ++++  I
Sbjct: 175 VILTNNYSLLGTIKLGGIDFLTTSKKDLIELHASIYSVFRNFVTPEFKFYFHTVKKKIVI 234

Query: 84  YPESR-----FFSSFAATLDEKYKKKM---VSQELYRNDLFVSLLWNPTSGKTEQLASFF 135
              +R     F + F    +EK K++    +S  L      +  L  P   K     + F
Sbjct: 235 DETNRDYGLIFSNDFMRAYNEKQKRESFYDISFYLTIEQDLLDTLNEPVMNKKHFADNNF 294

Query: 136 QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQL 195
           +   +  + + E   + I  IEEL       L  Y    L  Y  +GI++S+Q EF + L
Sbjct: 295 EEFQRIIRAKLENFKDRIELIEEL-------LSKYHPTRLKEYTKDGIIYSKQCEFYNFL 347

Query: 196 VGGRRERIPLTFGTIASTIYSDRVIFG---------KEMIEIRHESNERFVGMFGWKEYP 246
           VG         F      +Y    + G         K    +  + +E++       EY 
Sbjct: 348 VGMNEA----PFICNRKDLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYA 403

Query: 247 SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEA 306
            K++  + D +     EFI   ++  K+    +  +     ++I +    S +       
Sbjct: 404 PKSQSDLFDKINALDSEFIFMHAYSPKNSQVLKDKLAFTSRRIIISG--GSKEQGMTLGC 461

Query: 307 LDDLESNRFV-LGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           L +L  N  + LG +  SL +FAD  + + + + +  + L   G +       +E  ++A
Sbjct: 462 LSELVGNGDITLGSYGNSLVLFADSFEKMKQSVKECVSSLNAKGFLANAATFSMENYFFA 521

Query: 366 Q------LPGNFSYRARSGAITSRNFAALSPFHSFPI-GKLEGNVWGAAVALLKTQAGSP 418
           +      LP  F        +TS NFA      +    GK + N WG +V  LK++  SP
Sbjct: 522 KHCSFITLPFIFD-------VTSNNFADFIAMRAMSFDGKEDNNAWGNSVMTLKSEINSP 574

Query: 419 YYFNFHY------GDLGNTFVCGPSGSGKTVIVNFLLAQL-------------QKHNPTM 459
           +Y NFH          G+T + G +GSGKTV ++  L  +              K   TM
Sbjct: 575 FYLNFHMPTDFGSASAGHTLILGSTGSGKTVFMSMTLNAMGQFAYNFPANISKDKQKLTM 634

Query: 460 VFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLR------SWVLKL 513
           V+ DKD GA   + A GG+Y  ++ G  TG+ P       +K    +       S V +L
Sbjct: 635 VYMDKDYGAYGNIVAMGGEYVKIELGTDTGLNPFAWAACVQKTNATMEQKQTAISVVKEL 694

Query: 514 VTTEGQTVTEQERQ--DIAKAINSLESLPHAQRSL--GALQLFF-----------DNTSK 558
           V        E++     I+ ++    +L  A  +L  G + L +           D+   
Sbjct: 695 VKNLATKSDEKDENGNSISFSLADSNTLAAAVTNLITGDMNLDYPITQLINAFGKDHNDP 754

Query: 559 EGIAIRLQRWIKGN--DLGWVFDNDQDD-LNLDSQFIGYDMTDFLDNEEIRRPLMMYLFN 615
            G+  RL  + K    +  W+FDN   D L+     IG D + FLDN ++   +  YLF 
Sbjct: 755 NGLVARLAPFCKSTNGEFQWLFDNKATDRLDFSKTIIGVDGSSFLDNNDVSPFICFYLFA 814

Query: 616 RILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTI 675
           RI + +DGRR ++ IDE WK L D     F +D LKT RK+N ++  ATQS  D L   I
Sbjct: 815 RIQEAMDGRRFVLDIDEAWKYLGDPKVAYFVRDMLKTARKRNAIVRLATQSITDLLACPI 874

Query: 676 AHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQ-GQNSVV 734
           A TI EQCPT+IF  N   N  DY     +TE+EFE+I   L    R+ L KQ G  SV+
Sbjct: 875 ADTIREQCPTKIFLRNDGGNLSDYQRLANVTEKEFEIITKGL---DRKILYKQDGSPSVI 931

Query: 735 AELNLRGMNDE-IAILSGTTKNIELVNQIINDY 766
           A  NLRG+  E + ILS  T  ++ +++II ++
Sbjct: 932 ASFNLRGIPKEYLKILSTDTVFVKEIDKIIQNH 964
>hpy:HP0544 cag23; cag pathogenicity island protein 23 (picb protein); K03199
           type IV secretion system protein VirB4
          Length = 983

 Score =  247 bits (631), Expect = 7e-64
 Identities = 222/813 (27%), Positives = 354/813 (43%), Gaps = 93/813 (11%)

Query: 24  VIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRRETI 83
           VI  N+  L+  + + G++F T     L  LH  + ++ RN        Y H ++++  I
Sbjct: 175 VILTNNYSLLGTIKLGGIDFLTTSKKDLIELHASIYSVFRNFVTPEFKFYFHTVKKKIVI 234

Query: 84  YPESRFFSS-FAATLDEKYKKKMVSQELYRNDLFVSL-------LWNPTSGKTEQLASFF 135
              +R +S  F+      Y +K   +  Y    ++++       L  P   K     + F
Sbjct: 235 DETNRDYSLIFSNDFMRAYNEKQKRESFYDISFYLTIEQDLLDTLNEPVMNKKHFADNNF 294

Query: 136 QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQL 195
           +   +  + + E   + I  IEEL       L  Y    L  Y  +G+++S+Q EF + L
Sbjct: 295 EEFQRIIRAKLENFKDRIELIEEL-------LSKYHPIRLKEYTKDGVIYSKQCEFYNFL 347

Query: 196 VGGRRERIPLTFGTIASTIYSDRVIFG---------KEMIEIRHESNERFVGMFGWKEYP 246
           VG         F      +Y    + G         K    +  + +E++       EY 
Sbjct: 348 VGMNEA----PFICNRKDLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYA 403

Query: 247 SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEA 306
            K++  + D +     EFI   ++  K+    +  +     ++I +    S +       
Sbjct: 404 PKSQSDLFDKINALDSEFIFMHAYSPKNSQVLKDKLAFTSRRIIISG--GSKEQGMTLGC 461

Query: 307 LDDLESNRFV-LGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           L +L  N  + LG +  SL +FAD  + + + + +  + L   G +       +E  ++A
Sbjct: 462 LSELVGNGDITLGSYGNSLVLFADSFEKMKQSVKECVSSLNAKGFLANAATFSMENYFFA 521

Query: 366 Q------LPGNFSYRARSGAITSRNFAALSPFHSFPI-GKLEGNVWGAAVALLKTQAGSP 418
           +      LP  F        +TS NFA      +    G  E N WG +V  LK++  SP
Sbjct: 522 KHCSFITLPFIFD-------VTSNNFADFIAMRAMSFDGNQENNAWGNSVMTLKSEINSP 574

Query: 419 YYFNFHY------GDLGNTFVCGPSGSGKTVIVNFLLAQL-------------QKHNPTM 459
           +Y NFH          G+T + G +GSGKTV ++  L  +              K   TM
Sbjct: 575 FYLNFHMPTDFGSASAGHTLILGSTGSGKTVFMSMTLNAMGQFVHNFPANVSKDKQKLTM 634

Query: 460 VFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLR------SWVLKL 513
           V+ DKD GA   + A GG+Y  ++ G  TG+ P       +K    +       S V +L
Sbjct: 635 VYMDKDYGAYGNIVAMGGEYVKIELGTDTGLNPFAWAACVQKTNATMEQKQTAISVVKEL 694

Query: 514 VTTEGQTVTEQERQ--DIAKAINSLESLPHAQRSL--GALQLFF-----------DNTSK 558
           V        E++     I+ ++    +L  A  +L  G + L +           D+   
Sbjct: 695 VKNLATKSDEKDENGNSISFSLADSNTLAAAVTNLITGDMNLDYPITQLINAFGKDHNDP 754

Query: 559 EGIAIRLQRWIKGN--DLGWVFDNDQDD-LNLDSQFIGYDMTDFLDNEEIRRPLMMYLFN 615
            G+  RL  + K    +  W+FDN   D L+     IG D + FLDN ++   +  YLF 
Sbjct: 755 NGLVARLAPFCKSTNGEFQWLFDNKATDRLDFSKTIIGVDGSSFLDNNDVSPFICFYLFA 814

Query: 616 RILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTI 675
           RI + +DGRR ++ IDE WK L D     F +D LKT RK+N ++  ATQS  D L   I
Sbjct: 815 RIQEAMDGRRFVLDIDEAWKYLGDPKVAYFVRDMLKTARKRNAIVRLATQSITDLLACPI 874

Query: 676 AHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQ-GQNSVV 734
           A TI EQCPT+IF  N   N  DY     +TE+EFE+I   L    R+ L KQ G  SV+
Sbjct: 875 ADTIREQCPTKIFLRNDGGNLSDYQRLANVTEKEFEIITKGL---DRKILYKQDGSPSVI 931

Query: 735 AELNLRGMNDE-IAILSGTTKNIELVNQIINDY 766
           A  NLRG+  E + ILS  T  ++ +++II ++
Sbjct: 932 ASFNLRGIPKEYLKILSTDTVFVKEIDKIIQNH 964
>wbm:Wbm0750 type IV secretory pathway, VirB4 components; K03199 type IV
           secretion system protein VirB4
          Length = 784

 Score =  239 bits (610), Expect = 2e-61
 Identities = 184/779 (23%), Positives = 373/779 (47%), Gaps = 28/779 (3%)

Query: 7   ESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLN-TLLRNI 65
           ES+  ++IPY  H ++  I      L+ ++ +E    D +  ++ + L  ++  ++ +NI
Sbjct: 22  ESIDLDFIPYACHYDEETILTKQGELLKIIKLE----DYSSADNYSDLRTEIRKSISKNI 77

Query: 66  ADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPT 124
                 ++ H +R+R  +  +      F+  L   +  K+ + +L Y N+L++ +L +  
Sbjct: 78  DSLYFTVWIHTVRKRNKLSLKWNKTGDFSDKLHSTWLDKLTNSKLRYINELYIVILVSDF 137

Query: 125 SGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGIL 184
           + K    + FF  +    K   + + + ++++ +L Q     LE + A+ L++  +   +
Sbjct: 138 N-KHSNNSFFFGGIRNKHKLSLQENHQELQRVTDLIQS---DLEPFGAKKLALRFNGDKV 193

Query: 185 FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKE 244
           +SE  EFLH +V    +  P+    ++  I + ++ FG    +   E+ ++F  +F  KE
Sbjct: 194 YSEMIEFLHYIVTLTHKDHPICERDLSQYIKNLKIAFGFNTFQTIFENQQKFGSVFCIKE 253

Query: 245 YPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALD 304
           Y  +   G  D  L    E I+T+  +F S   A     ++ N +  + D    +   + 
Sbjct: 254 Y-REIPLGNIDRCLQLDSELIITEIIIFTSNNKAMKEFKKQINMLQVSEDNTLLRNSEIK 312

Query: 305 EALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWW 364
           E ++   ++     +  +   +FAD    L E +S   + ++  G ++ R DL +E  +W
Sbjct: 313 EIIELEGTSTIDFCQQKIIFTIFADDRNRLAENISSLSSVMSLIGLMMFRTDLHMENHFW 372

Query: 365 AQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFH 424
           AQLPGNF++  +   I ++   + +  H F  G L+G  W  AV +  ++ GSPY+FNFH
Sbjct: 373 AQLPGNFAFVTQPKNILAKYACSFAMLHDFTSGTLKGGRWKEAVTVFFSKKGSPYFFNFH 432

Query: 425 -YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY---K 480
              + G+T + G   SG+T ++NFLL++ +K NP ++  D    + IF +A  GKY    
Sbjct: 433 GKKNNGHTTILGAPNSGRTSLINFLLSESRKFNPRIIILDNTGKSIIFTKAVSGKYYIID 492

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           P    +     PL  +E +  N+  L   + ++V     T     ++ I K ++S+ ++P
Sbjct: 493 PKYKNKSLKFNPL-NIEDSASNRSMLVELIKRMV---ADTSLVGIKEKIKKVVDSIFAIP 548

Query: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVF-DNDQDDLNLDSQFIGYDMTDF 599
              RS+  +         +G   ++ +W    +  ++F D+D+ D++   + I  +  + 
Sbjct: 549 RESRSISRISEML--LLLKG---KISKWCGDGEFAYLFQDSDESDIDWKIKTISLNTANL 603

Query: 600 LDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGM 659
             ++E    ++ Y         DG   I+V+DE W+       +    + ++ + + N +
Sbjct: 604 TKHKECMSVILYYFLYSFEAQCDGSPAILVLDEAWEISSIFPTEEGFDNWMQRMTELNVV 663

Query: 660 MLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSR 719
           ++ +T++   A  S     + +   T+I  PN  AN + Y++ F L++ E  +I    ++
Sbjct: 664 VILSTENLNLAFASEFTQYLDKHVDTRILMPNFNAN-RLYMKAFSLSKEELNIILQTPTQ 722

Query: 720 ESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFH 778
           E   FLIKQ +  V   L+L+ +  EI +LS   + I+ + + I + G + + WLP+F+
Sbjct: 723 EG-LFLIKQYKGLVTLNLDLKNI-QEIHVLSANRETIKYMYEAIKEKGEEVNKWLPVFY 779
>ama:AM1053 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 809

 Score =  215 bits (547), Expect = 4e-54
 Identities = 182/777 (23%), Positives = 346/777 (44%), Gaps = 30/777 (3%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           E+I    H N+  +   S  L+ ++ +E    D AD + L SL + + T++ N+ D  +A
Sbjct: 49  EFIAPACHYNEETLLNKSGGLVQIIRIE----DYADSSGLGSLRDAIRTVISNVRDPSIA 104

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQL 131
            + + +R       +      F+ +L   Y+  + S+  Y N+++++++  P   K + +
Sbjct: 105 FWLYTVREECKFKLDWHETRDFSDSLHSLYEDSIGSRRTYANEVYIAVVTQPLREKLDGM 164

Query: 132 ASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFSEQSE 190
            S      + KK         ++++  ++  ++  L+ + AR L V    +G   SE  E
Sbjct: 165 ISALT-FGRVKKRHKSFLASKVQQLSRVTSAMVAELQCFSARKLGVVRCEDGKWRSELLE 223

Query: 191 FLHQLVGGRRERIPLTFGTIASTIYSD-RVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           FL  LV  RR    L F   A TI +   +  G   ++I  +   R+  + G KEY  ++
Sbjct: 224 FLSYLVTLRRGERFLEFRDSAHTIAAGCGLAVGFNTLKISDQEGARYGAILGVKEYTGES 283

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
              + D  L    EF++T+   F      +    R+   +  + D   ++I  L+E +  
Sbjct: 284 LDAI-DMCLQQECEFVITEVIQFVPSVQVKDAYRRQTELLEISGDAELAKIARLEEVMST 342

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
            ES+     +  +S  V ++   +L + + K  A  +  GA++ R DL LE  +WA +PG
Sbjct: 343 DESSIGDCCKRKVSCMVISNSVPSLKKDIKKMVAAFSELGAIVVRVDLALEDDFWANMPG 402

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDLG 429
           +F Y         +     +  H FP G L+G  W  A+ L  +    PY+F+FH GD G
Sbjct: 403 SFRYVLGMRFAMVKAACTFAMTHHFPSGALKGGRWHEAITLFFSNQNLPYFFSFHAGDKG 462

Query: 430 NTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPL--KNGQP 487
           +T   GP  S  T+I+NF++++ ++     V FD    + IF  A  G+Y  +  + G+ 
Sbjct: 463 HTLCLGPQDSHMTLIMNFIISESRRLRVKSVVFDYSGKSIIFATAINGQYNRIDDRQGKV 522

Query: 488 TGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLG 547
           T       +  T  N+      V ++  T  +  +E  +    + ++ + S+P   R+  
Sbjct: 523 TQFFNPFNVHDTPINREIAVGVVERMAGTL-EPPSEAIKLAAREVVDKIFSIPMESRTPD 581

Query: 548 ALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRR 607
            ++   +   +   A     W           +D  ++ LD +F+  ++      +E   
Sbjct: 582 KVRECIEMLGESARA-----WWGAQGAFSRLISDTTEIELDGEFVVINVGMLAGKQECMG 636

Query: 608 PLMMYLFNRILDLIDGRRIIIVIDEFWKA----LEDDSFKAFAQDRLKTIRKQNGMMLFA 663
            ++ +L   + +  +G   I+V+ E W       ++  F A+    ++ +  +N +++FA
Sbjct: 637 AILYFLLRSLENRFNGEPTILVMYEAWVMDVVFPDESEFDAW----MERLTARNVVVVFA 692

Query: 664 TQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRR 723
            ++ +    S +     +   T+IF PN     +  V  F L++ E + +  ++      
Sbjct: 693 AENIRAISTSKLIRYASKHIETRIFMPNVIIGSQQQVRVFGLSKEEVD-VMLQIPHHEGH 751

Query: 724 FLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           F IKQG +SVV  L LR  + E  +LS     I+L+ + I + G D   WLP FH +
Sbjct: 752 FFIKQGSSSVVLALKLR--DKETRVLSANRTTIKLMYEAIAEKGKD---WLPAFHAK 803
>ecn:Ecaj_0839 CagE, TrbE, VirB family component of typeIV transporter system;
           K03199 type IV secretion system protein VirB4
          Length = 791

 Score =  214 bits (544), Expect = 8e-54
 Identities = 181/788 (22%), Positives = 357/788 (45%), Gaps = 48/788 (6%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P   H +++ I   +  L+ V+ VE     T  IN  +      N+++ ++    V+
Sbjct: 30  DFVPSACHYDENTILNKNGELVQVIKVEDYVL-THHINEKDLRAAVRNSIVNSVKVPEVS 88

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQL 131
            + + +R++          +  +  L   +   +  +  Y N+L+++++   T+   E +
Sbjct: 89  FWIYTVRKQHNFDLLQCKTNDVSDVLSSAHVDNISKRVTYINELYIAIV---TNHLPESM 145

Query: 132 ASFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLS-VYAHEGILFSEQ 188
              F  L+ +       D     + ++ +++  +++ L+ +EA+ L  V   E  + SE 
Sbjct: 146 KGVFGALSFSYIKNKHEDFLKNKVIRLNKITASILESLKKFEAKKLGLVVVDEEKVRSEL 205

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
            EF + L   R +   L    I+S   +  +  G    ++  +  ++F  +   K+Y   
Sbjct: 206 IEFFYYLTVMRHKECLLDVADISSICSNHDINMGFNTFKVSCDDVQKFGAILAIKDYQES 265

Query: 249 TRPGMTDGLLTAPFEFILTQSFVF-KSKAAARVIMGRKQNQMINAA-DRASSQIDALDEA 306
               + D  L   +EFI+ +   F KSK A ++   +KQ   +  + D    ++  +D+ 
Sbjct: 266 PLDAV-DECLQQDYEFIIVEIIKFVKSKNALKLF--QKQATFLEFSNDLQLKKLSNIDDF 322

Query: 307 LDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQ 366
           +    ++     E  ++  + ++    L   ++K  + L   G V  R DL +E  +W+ 
Sbjct: 323 VSVDANSYLNFCERKINFVIMSNTLSQLRGNINKTVSSLAALGIVCVRCDLTMEDDFWSH 382

Query: 367 LPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYG 426
           LPGNF+Y         +   A S  H FP G L+GN WG AV +  +  G PY+FNFH  
Sbjct: 383 LPGNFAYILNFKCTLLKYACAFSLLHYFPSGALQGNKWGQAVTMFFSNKGRPYFFNFHVM 442

Query: 427 DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQ 486
           D GNT + G   S  T+++NFLL++ +K N  ++  D    + IF++A GGKY    + +
Sbjct: 443 DKGNTLMVGSPQSSVTMLLNFLLSESRKLNTRIISLDYTGKSIIFIKAIGGKYYRADHRR 502

Query: 487 PTGIAPLKGMEYTEKNKIFLR----SWVLKLVT------TEGQTVTEQERQDIAKAINSL 536
                     +Y E +  F +        K+VT         + +TE+ +  I + ++ +
Sbjct: 503 ----------DYQEMSFNFFQLEDNDLSRKIVTGVLQRMLNVKNITEEMKSSINQVVDHI 552

Query: 537 ESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDM 596
            +LP   R++  +    D+ S  G+   + +W+   +   +   D  +++  ++ +G ++
Sbjct: 553 FTLPIESRTISNIA---DHIS--GLGKNVNQWVNNGEFAHLLKED-SNIDWKAKVLGLNV 606

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA----LEDDSFKAFAQDRLKT 652
                  +    ++ Y  N +++ +DG   I+VIDE W      + D  F     + + T
Sbjct: 607 GIVFSKPQCASVIIYYFLNMLINYLDGSPTILVIDEAWILDYIFVNDKEF----DEWIDT 662

Query: 653 IRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFEL 712
           + K N +++F  ++    ++S I +   +   TQIF PN  +  K Y++ F L++ E   
Sbjct: 663 MNKLNVVIVFTGENIPAIVSSNIIYKFNQYVETQIFMPNSVSTSKMYMKAFNLSKSECNT 722

Query: 713 IQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDT 772
           +  ++  +   F IKQ   SVV   NL  +  E  IL      I  + + IN +G D   
Sbjct: 723 M-FQMPSQGGYFFIKQDSASVVLSFNLPNI-PETNILVANKNTIRYMYESINSHGDDVKE 780

Query: 773 WLPIFHQR 780
           WLP F+++
Sbjct: 781 WLPTFYKK 788
>erw:ERWE_CDS_08440 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 790

 Score =  214 bits (544), Expect = 8e-54
 Identities = 179/778 (23%), Positives = 355/778 (45%), Gaps = 30/778 (3%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           ++P   H +++ I   +  L+ ++ +E    +T D +    + N + +   ++    V+ 
Sbjct: 30  FVPAACHYDENTILNKNGELLQIIKIEDYVLNTQDTDLRTIVRNSIAS---SVTTPEVSF 86

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + + IR+              +  + E + K +  Q  Y N+L+++++   T    E + 
Sbjct: 87  WIYTIRKLHKFDLSRESIDDVSDVIHETHMKYVGQQVTYINELYIAVV---THNLPENIK 143

Query: 133 SFFQRLT--KAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH-EGILFSEQS 189
           S    L+    K    E     + ++ +++  +++ L+ +EAR L +  + EG   SE  
Sbjct: 144 SLLGALSFPYVKNKHKEFLKNKLVRLNKITGSILENLKGFEARKLGLLPNNEGKTRSELI 203

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           EF   L   R +   L    IA       +  G    +I    + +F  +   K+Y    
Sbjct: 204 EFFFYLTTMRYKECLLDVADIAGVCACYDISMGFNTFKISDRDSHKFGAILAIKDYHESP 263

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAA-DRASSQIDALDEALD 308
              + DG L    EF++ +   F +K    V   +KQ Q++  + D    Q   +DE + 
Sbjct: 264 LDSV-DGCLQQNCEFMIVEIMKF-TKGKNVVKFFQKQAQLLEVSNDVHLKQATNIDEFVS 321

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
              S+     E  ++  + +D  + L   ++K    L++ G +  R DL +E  +WA LP
Sbjct: 322 TDVSSCLNFCERKINFVIASDTLQQLQININKFIISLSSLGILCVRSDLTMEDDFWAHLP 381

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GNFS+        ++   A +  H FP G L+GN WG A+ +  +  G PY+F+FH  D 
Sbjct: 382 GNFSHVLNIRYTLTKYACAFALLHYFPSGALQGNKWGQAITIFFSNKGRPYFFSFHVKDR 441

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPT 488
           G+T + G   S  TV+++FLL + +K +  ++  D    + IF +A  GKY    +    
Sbjct: 442 GHTLMVGSPQSSVTVLLHFLLLESRKFDTRIIILDYRGKSIIFTKAINGKYYRADHRPDH 501

Query: 489 GIAPLK--GMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSL 546
                    +E ++ N+  +   + ++       ++E+ R  I + +  + SLP   R++
Sbjct: 502 HEVSFNFFQLEDSDVNRKIISGILQRMSCVNVANMSEEMRNTIDEIVEYIFSLPIEDRNI 561

Query: 547 GALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD--SQFIGYDMTDFLDNEE 604
           G++    D+ S+ G      RW+   +   +    +D +N+D  ++ +G ++   L N +
Sbjct: 562 GSIT---DHVSRLG--KNASRWVNDGEFAHLL---KDGVNIDWSAKILGLNVGVVLSNPQ 613

Query: 605 IRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ--DRLKTIRKQNGMMLF 662
               ++ Y  + +++ +DG   I+V+DE W  + D  F +  +  D ++ + + N +++F
Sbjct: 614 CAAVIIYYFLSILVNYLDGSPTILVVDESW--ILDYVFTSDQELDDWVEMMSQLNVVIIF 671

Query: 663 ATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESR 722
           + ++    ++S++     +   TQIF PN  +  K Y++ F L++ E   +    S+E  
Sbjct: 672 SGENIPAVVSSSVICGFNKHVETQIFMPNSVSTNKLYMKAFNLSKTECNTMFQMPSQEG- 730

Query: 723 RFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
            F +KQ   S+V    L  +  E  +L+ T + I  + + IN  G D   WLP F+ +
Sbjct: 731 YFFVKQCNVSIVLSFQLPNI-PEANVLTATQETIRYMYESINSCGNDAKEWLPAFYSK 787
>eru:Erum7980 putative type IV secretion system protein; K03199 type IV secretion
           system protein VirB4
          Length = 790

 Score =  214 bits (544), Expect = 8e-54
 Identities = 179/778 (23%), Positives = 355/778 (45%), Gaps = 30/778 (3%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           ++P   H +++ I   +  L+ ++ +E    +T D +    + N + +   ++    V+ 
Sbjct: 30  FVPAACHYDENTILNKNGELLQIIKIEDYVLNTQDTDLRTIVRNSIAS---SVTTPEVSF 86

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + + IR+              +  + E + K +  Q  Y N+L+++++   T    E + 
Sbjct: 87  WIYTIRKLHKFDLSRESIDDVSDVIHETHMKYVGQQVTYINELYIAVV---THNLPENIK 143

Query: 133 SFFQRLT--KAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH-EGILFSEQS 189
           S    L+    K    E     + ++ +++  +++ L+ +EAR L +  + EG   SE  
Sbjct: 144 SLLGALSFPYVKNKHKEFLKNKLVRLNKITGSILENLKGFEARKLGLLPNNEGKTRSELI 203

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           EF   L   R +   L    IA       +  G    +I    + +F  +   K+Y    
Sbjct: 204 EFFFYLTTMRYKECLLDVADIAGVCACYDISMGFNTFKISDRDSHKFGAILAIKDYHESP 263

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAA-DRASSQIDALDEALD 308
              + DG L    EF++ +   F +K    V   +KQ Q++  + D    Q   +DE + 
Sbjct: 264 LDSV-DGCLQQNCEFMIVEIMKF-TKGKNVVKFFQKQAQLLEVSNDVHLKQATNIDEFVS 321

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
              S+     E  ++  + +D  + L   ++K    L++ G +  R DL +E  +WA LP
Sbjct: 322 TDVSSCLNFCERKINFVIASDTLQQLQININKFIISLSSLGILCVRSDLTMEDDFWAHLP 381

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GNFS+        ++   A +  H FP G L+GN WG A+ +  +  G PY+F+FH  D 
Sbjct: 382 GNFSHVLNIRYTLTKYACAFALLHYFPSGALQGNKWGQAITIFFSNKGRPYFFSFHVKDR 441

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPT 488
           G+T + G   S  TV+++FLL + +K +  ++  D    + IF +A  GKY    +    
Sbjct: 442 GHTLMVGSPQSSVTVLLHFLLLESRKFDTRIIILDYRGKSIIFTKAINGKYYRADHRPDH 501

Query: 489 GIAPLK--GMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSL 546
                    +E ++ N+  +   + ++       ++E+ R  I + +  + SLP   R++
Sbjct: 502 HEVSFNFFQLEDSDVNRKIISGILQRMSCVNVANMSEEMRNTIDEIVEYIFSLPIEDRNI 561

Query: 547 GALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD--SQFIGYDMTDFLDNEE 604
           G++    D+ S+ G      RW+   +   +    +D +N+D  ++ +G ++   L N +
Sbjct: 562 GSIT---DHVSRLG--KNASRWVNDGEFAHLL---KDGVNIDWSAKILGLNVGVVLSNPQ 613

Query: 605 IRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ--DRLKTIRKQNGMMLF 662
               ++ Y  + +++ +DG   I+V+DE W  + D  F +  +  D ++ + + N +++F
Sbjct: 614 CAAVIIYYFLSILVNYLDGSPTILVVDESW--ILDYVFTSDQELDDWVEMMSQLNVVIIF 671

Query: 663 ATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESR 722
           + ++    ++S++     +   TQIF PN  +  K Y++ F L++ E   +    S+E  
Sbjct: 672 SGENIPAVVSSSVICGFNKHVETQIFMPNSVSTNKLYMKAFNLSKTECNTMFQMPSQEG- 730

Query: 723 RFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
            F +KQ   S+V    L  +  E  +L+ T + I  + + IN  G D   WLP F+ +
Sbjct: 731 YFFVKQCNVSIVLSFQLPNI-PEANVLTATQETIRYMYESINSCGNDAKEWLPAFYSK 787
>erg:ERGA_CDS_08350 virB4; VirB4 protein; K03199 type IV secretion system protein VirB4
          Length = 790

 Score =  213 bits (541), Expect = 2e-53
 Identities = 180/781 (23%), Positives = 357/781 (45%), Gaps = 36/781 (4%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           ++P   H +++ I   +  L+ ++ +E    +T D +    + N + +   ++    V+ 
Sbjct: 30  FVPAACHYDENTILNKNGELLQIIKIEDYILNTQDTDLRTIVRNSIAS---SVTTPEVSF 86

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + + IR+              +  + E + K +  Q  Y N+L+++++   T    E + 
Sbjct: 87  WIYTIRKLHKFDLSRESIDDVSDVIHETHMKYVSQQVTYINELYIAVV---THHLPENIK 143

Query: 133 SFFQRLT--KAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH-EGILFSEQS 189
           S    L+    K    E     + ++ +++  +++ L+ +EAR L +  + EG + SE  
Sbjct: 144 SLLGALSFPYVKNKHKEFLKNKVIRLNKITGSILENLKGFEARKLGLLPNNEGKIRSELI 203

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           EF   L   R +   L    IA       +  G    +I   ++ +F  +   K+Y    
Sbjct: 204 EFFFYLTTMRYKECLLDVADIAGVCACYDISMGFNTFKISDRNSHKFGAILAIKDYHESP 263

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAA-DRASSQIDALDEALD 308
              + DG L    EF++ +   F +K    V   +KQ Q++  + D    Q   +DE + 
Sbjct: 264 LDSV-DGCLQQNCEFMIVEIMKF-TKGKNVVKFFQKQAQLLEVSNDIHLKQATNIDEFVS 321

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
              S+     E  ++  + +D  + L   ++K    L++ G +  R DL +E  +WA LP
Sbjct: 322 TDVSSCLNFCERKINFVIASDTLQQLQININKFIISLSSLGILCVRSDLTMEDDFWAHLP 381

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GNFS+        ++   A +  H FP G L+GN WG A+ +  +  G PY+F+FH  D 
Sbjct: 382 GNFSHVLNIRYTLTKYACAFALLHYFPSGALQGNKWGQAITIFFSNKGRPYFFSFHVKDR 441

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY-----KPLK 483
           G+T + G   S  TV+++FLL + +K +  ++  D    + IF +A  GKY     +P  
Sbjct: 442 GHTLMVGSPQSSVTVLLHFLLLESRKFDTRIIILDYRGKSIIFTKAINGKYYRADHRPDH 501

Query: 484 NGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQ 543
           +        LK    ++ N+  +   + ++       ++E+ +  I + +  + SLP   
Sbjct: 502 HEVSFNFFQLKD---SDVNRKIISGILQRMSCVNVANMSEEMKNTIDEIVEYIFSLPIED 558

Query: 544 RSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD--SQFIGYDMTDFLD 601
           R++G +    D+ ++ G      RW+   +   +    +D +N+D  ++ +G ++   L 
Sbjct: 559 RNVGNIT---DHVTRLG--KNASRWVNDGEFAHLL---KDGVNIDWNAKILGLNVGVVLS 610

Query: 602 NEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ--DRLKTIRKQNGM 659
           N +    ++ Y  N +++ +DG   I+V+DE W  + D  F +  +  D +K + + N +
Sbjct: 611 NPQCAAVIIYYFLNILVNYLDGSPTILVVDESW--ILDYVFTSDQELDDWVKMMSQLNVV 668

Query: 660 MLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSR 719
           ++F+ ++    ++S++     +   TQIF PN  +  K Y++ F L++ E   +    S+
Sbjct: 669 IIFSGENIPAVVSSSVICGFNKHVETQIFMPNSVSTNKLYMKAFNLSKTECNTMFQMPSQ 728

Query: 720 ESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQ 779
           E   F +KQ   S+V    L  +  E  +L+ T + I  + + IN    D   WLP F+ 
Sbjct: 729 EG-YFFVKQCNVSIVLSFQLPNI-PEANVLTATQETIRYMYESINSCSNDVKEWLPAFYS 786

Query: 780 R 780
           +
Sbjct: 787 K 787
>rfe:RF_1250 virB4_2; type IV secretion/conjugal transfer ATPase, VirB4 family;
           K03199 type IV secretion system protein VirB4
          Length = 810

 Score =  212 bits (539), Expect = 3e-53
 Identities = 193/805 (23%), Positives = 366/805 (45%), Gaps = 67/805 (8%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP   H NQ+ +      L+ ++ + G+N +    N  N       ++ +NI D   A 
Sbjct: 20  FIPIACHYNQNTLLTKDGKLLQIIKIHGINSEKISDNIQNLREMVRVSIKKNITDYDFAF 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + H IR ++ +   + +     A +   +++K    + + N L++S++ +      +   
Sbjct: 80  WLHTIREKQNLDDSTPYKKLLPANIHALWQRKNHWNDKFVNTLYISIVHDSAKVDIKNFN 139

Query: 133 SFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           S    L+    T  E +    A +K+E ++ +++  L  + A  L +      +FS    
Sbjct: 140 SLINSLSNKLITDFENNYLDSAFQKLENITNNILNDLNEFGAEKLGIIFENDNIFSNPL- 198

Query: 191 FLHQLVGGRRER---IPLT--FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           FL+  +         +P+      +  +IY+   I G +M+   HE N +F  +   KEY
Sbjct: 199 FLYNRIANLNNNDCLVPIIDLSDALGRSIYT---ISGDKMVVTDHEKNNKFASLLSIKEY 255

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRAS----SQID 301
             +T     D  L  P E I+T+ F F SK    +   R Q+ ++   + ++      I+
Sbjct: 256 -QETPSNTLDKFLQLPIELIITEIFYFVSKKQV-ISKLRGQDHILKITNDSTLLNHKGIN 313

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LD A  D     F      +S+AV  +    L   ++KA   L   G +  +EDL +E 
Sbjct: 314 KLDAANLD-----FQFCNQQISIAVIEEDENKLDAAVAKASTELFKLGIIHVKEDLNIEQ 368

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
            +W+QLP NF++  R   ++    A+L+  H+  +G  + N WG A+ LL+T+ G+PY+ 
Sbjct: 369 IFWSQLPANFAFIRRMSPLSVEYIASLTALHNTTLGN-QYNPWGKAITLLRTEKGTPYFM 427

Query: 422 NFH-YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY- 479
           NFH   + GNT + G   +GKTV++NFL+++  K++PT+++   +  ++IF+ +  GK+ 
Sbjct: 428 NFHDKTNKGNTCIFGTEKTGKTVLLNFLISESTKYDPTIIYISNNNDSKIFIESIEGKWL 487

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLES 538
           +P K      I P   ++ TEK++ F+  + LKL++      ++E E   + K  N + S
Sbjct: 488 EPDKQ----IINPFL-VDDTEKSQAFILEF-LKLISGHYISPLSEIEISFLEKLKNKILS 541

Query: 539 LPHAQRSLGALQLFFDNTSKEGIAI--RLQRWIKGNDLGWVFDNDQDDLNL-DSQFIGYD 595
           +   +R    +    D   + GI I  +L+ + +G     +F  D+  LN+ + + IG++
Sbjct: 542 IEKEKRIFSDILKLEDFKEEGGIQILDKLKVFTEGQLYFGLF--DRPPLNIEEGKVIGFN 599

Query: 596 MTDFLDN--------------EEIRRPL---------MMYLFNRILDLIDGRRIIIVIDE 632
           +    D               E+    L         ++Y F   L L+  +  I   D 
Sbjct: 600 LYKLSDEPFSKQFYPTERKFLEQFNNNLKKHQAICAGVIYAFTYHLSLVGTKPKIFAADN 659

Query: 633 FWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTI---IEQCPTQIFF 689
           F K    + +          + + NG  +F +      L S   +TI   ++   T+I  
Sbjct: 660 FDKLYRPEVYYDNINLIYNNLSQNNG--IFVSNFNFIYLKSYPKYTIKPWLDLINTKIIL 717

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           P+     +D  +   L+E E   + S+L   +R FLI +   S+ +EL++  +   + IL
Sbjct: 718 PSD-VKIEDLDKILGLSEPEIRKL-SQLILSARMFLINKDNESIASELSIAALIGIVRIL 775

Query: 750 SGTTKNIELVNQIINDYGADPDTWL 774
           S   + +++ N+I+  +   PD W+
Sbjct: 776 SSRQEEMDIYNKILEQHQGPPDNWI 800
>ech:ECH_1041 virB4-2; type IV secretion system protein VirB4
          Length = 791

 Score =  206 bits (524), Expect = 2e-51
 Identities = 176/780 (22%), Positives = 357/780 (45%), Gaps = 32/780 (4%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           ++IP   H +++ I      L+ ++ +E     T  +N  +      N+++ ++    V+
Sbjct: 30  DFIPAACHYDENTILNKDGELVQIIKIEDYVL-THYVNDKDLRTVVRNSIVNSVEVPEVS 88

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWN--PTSGKTE 129
            + + +R+        +  +  +  L   +   +  +  Y N+L+++++ N  P S K  
Sbjct: 89  FWIYTVRKPHKFDFARKSINDVSDALGSAHLNNIGQRVTYINELYIAVVTNHLPESMKGV 148

Query: 130 QLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLS-VYAHEGILFSEQ 188
             A  F  +    K   +  ++ + K+   +  +++ L+ +E R L  +   +  + SE 
Sbjct: 149 LGALSFSYVKNKHKDFLKNKIDRLNKV---TASILENLKKFEVRKLGLIVIDKEKVRSEL 205

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
            EFL+ L     +   L    I+       +  G    +I  ++N+RF  +   K+Y   
Sbjct: 206 IEFLYYLTMMHHKECFLDMVDISGICSHCSISMGFNTFKISCDNNQRFGAILAIKDYQDS 265

Query: 249 TRPGMTDGLLTAPFEFILTQSFVF-KSKAAARVIMGRKQNQMINAA-DRASSQIDALDEA 306
               + D  L   + FI+ +   F KSK A ++   +KQ   +  + D    ++  +D+ 
Sbjct: 266 PLDAV-DECLQQDYGFIVVEIIKFAKSKNALKLF--QKQATFLECSNDFQLRKLSNIDDF 322

Query: 307 LDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQ 366
           +    ++     E  ++  + +D    L   + +A   L++ G +  R DL +E  +WA 
Sbjct: 323 VSVDPNSNLSFCERKINFVIMSDTLPQLHNNIDRAVNSLSSLGIICVRCDLSMEDDFWAH 382

Query: 367 LPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYG 426
           LPGNFSY         +   A S  H FP G L+GN WG A+ +  +  G PY+F+FH  
Sbjct: 383 LPGNFSYILNFRYTLIKYACAFSLLHYFPSGALQGNKWGQAITMFFSNKGKPYFFSFHVF 442

Query: 427 DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQ 486
           D G+T + G   S  T+++NFLL++  + N  +V  D    + +FV+A GG+Y    + +
Sbjct: 443 DKGHTLMVGSPQSSVTMLLNFLLSESMQLNARIVLLDYTGKSIVFVKAMGGQYYRADHRR 502

Query: 487 PTGIAPLK--GMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQR 544
                      +E T  N+  +   + +++    + +TE+    I + +N L +LP   R
Sbjct: 503 DYQEMSFNFFQVEDTALNRRIVTGVLQRMLNV--KNITEEVNSAIDRIVNDLFTLPLESR 560

Query: 545 SLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD--SQFIGYDMTDFLDN 602
           ++ ++    D+ S  G      +W+   +   +    ++D N+D  ++ +G ++      
Sbjct: 561 TINSIA---DHVSTLG--TNASQWLNNGEFAHLL---KEDANIDWAAKVLGLNIGILFSK 612

Query: 603 EEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ--DRLKTIRKQNGMM 660
            +    ++ Y  + +++ +DG   ++VIDE W  + D  F +  +  + ++ + K N ++
Sbjct: 613 PQCASVIVYYFLHALINYLDGSPTVLVIDEAW--ILDYVFTSDQEFDEWIEMMNKLNVVV 670

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
           +FA ++    ++S I     +   TQ+F PN  +  K Y+  F L++ E   +    S+E
Sbjct: 671 VFAGENIPAIISSNIICRFNQHVETQVFMPNSVSTNKMYMRAFNLSKSECNTMFQMPSQE 730

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
              F +KQ  +SVV   NL  +  E  +LS     I  + + I+ +G +   WLP F+++
Sbjct: 731 G-YFFVKQDNDSVVLSFNLPNI-PETNVLSANKNTIRYMYESISSHGDNVREWLPAFYKK 788
>rco:RC1217 virB4; virB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 810

 Score =  202 bits (515), Expect = 2e-50
 Identities = 185/804 (23%), Positives = 362/804 (45%), Gaps = 65/804 (8%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP   H N++ +      L+ ++ + G+  +    N  N       ++ +NI D   A 
Sbjct: 20  FIPIACHYNENTLLTKDGKLLQIIKIHGITSEKISDNIQNLREMVRVSIKKNITDYDFAF 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + H IR ++ +   + +     A +   +++K    + + N L++S++ +          
Sbjct: 80  WLHTIREKQNLDDSTPYKKLLPANIHTLWQRKNHWNDKFVNTLYISIVHDSAKVNITNFN 139

Query: 133 SFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           S    L+    T  E +    A +K++ ++ +++  L  + A  L +      +FS    
Sbjct: 140 SLINSLSHKLITDFENNYLDSAFQKLDNITNNILNDLNEFSAEKLGIIFENDNVFSNPL- 198

Query: 191 FLHQLVGGRRER---IPLT--FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           FL+  +         +P+      I  +IY+   I   +M+   HE N +FV +   KEY
Sbjct: 199 FLYNRIANLNNNDCLVPIIDLSDAIGRSIYT---ISSDKMVVTDHEKNNKFVSLLSIKEY 255

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRAS----SQID 301
             +T     D  L  P E I+T+ F F SK    +   R Q+ ++   + ++      I+
Sbjct: 256 -HETPSNTLDKFLQLPIELIITEIFYFVSKKQV-ISKLRGQDYILKITNDSTLLNHKGIN 313

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LD A  D     F      +S+AV  +    L   ++KA   L   G +  +ED+ +E 
Sbjct: 314 KLDAANLD-----FQFCNQQISIAVIEEDENKLDAAVAKASTELFKLGIIHVKEDINIEQ 368

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
            +W+QLP NF++  R   ++  + A+L+  H+  +G  + N WG A+ LL+T+ G+PY+ 
Sbjct: 369 IFWSQLPANFAFIRRMSPLSVEHIASLTALHNTTLGN-QYNPWGKAITLLRTEKGTPYFM 427

Query: 422 NFH-YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY- 479
           NFH   + GNT + G   +GKTV++NFL+++  K++PT+++   +  ++IF+ A  GK+ 
Sbjct: 428 NFHDKTNKGNTCIFGTGKTGKTVLLNFLISESTKYDPTIIYISNNNDSKIFIEAIEGKWL 487

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLES 538
           +P K      I P   ++ TEK++ F+  + LKL++      ++E E   + K  N + S
Sbjct: 488 EPDKQ----IINPFL-VDDTEKSQAFILEF-LKLISGHYISPLSEIEISFLEKLKNKILS 541

Query: 539 LPHAQRSLGALQLFFDNTSKEGIAI--RLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDM 596
           +   +R    +    D   + GI I  +L+ + +      +FD    ++  + + IG+++
Sbjct: 542 IEKEKRIFSDILKLEDFKEEGGIQILDKLKVFTEEQLYSGLFDGSSLNIE-EGKVIGFNL 600

Query: 597 TDFLD------------------NEEIRR-----PLMMYLFNRILDLIDGRRIIIVIDEF 633
               D                  N  +++       ++Y F   L L+  +  I   D F
Sbjct: 601 YKLSDEPFSKQFYPTERKFLEQFNNNLKKHQSISAAVIYAFTYHLSLVGTKPKIFAADNF 660

Query: 634 WKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTI---IEQCPTQIFFP 690
            K    + +          + + NG  +F +      L S   +TI   ++   T+I  P
Sbjct: 661 DKLYRPEIYYDNINLIYNNLSQNNG--IFVSNFNFIYLKSYPKYTIKPWLDLINTKIILP 718

Query: 691 NQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILS 750
           +     +D  +   L++ E   + S+L   +R FLI +   S+ +EL++  +   + ILS
Sbjct: 719 SD-VKIEDLDKILGLSKPEIRKL-SQLILSARMFLISKDNESIASELSIAALIGVVRILS 776

Query: 751 GTTKNIELVNQIINDYGADPDTWL 774
              + +++  +I+  +   PD W+
Sbjct: 777 SRQEEMDIYKKILEQHQGPPDNWV 800
>rpa:RPA2230 trbE1; conjugal transfer protein trbE; K03199 type IV secretion
           system protein VirB4
          Length = 815

 Score =  202 bits (514), Expect = 3e-50
 Identities = 179/740 (24%), Positives = 328/740 (44%), Gaps = 63/740 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V + VI              G + D+A    L S  ++LN  LR +     A
Sbjct: 20  DFLPWAALVAEGVILNKDGSFQRTARFRGPDLDSATPAELVSTTSRLNNALRRLGSGW-A 78

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL---YRNDLFVSLLWNPTSGKT 128
           ++    R   + YP   F    +  +D  ++++    E    Y +  ++SL+W P +   
Sbjct: 79  IFVEAQRHPASAYPPGTFPDGVSNLVD--FERRAQFDEAGAHYESSYYLSLVWLPPAEDA 136

Query: 129 EQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQ 188
            +  ++     +         +       +   +L+ G     A L  +         E 
Sbjct: 137 ARAEAWLYEGREQSGINGHEQLATFIDRTDRVLNLVDGFMPETAWLSDI---------ET 187

Query: 189 SEFLHQLVGGRRE--RIPLTFGTIASTIYSDRVIFGKEMIEIR-HESNERFVGMFGWKEY 245
             +LH  V   R   R+P T   +   I +D+V+ G   +E R  +++ R + + G   +
Sbjct: 188 LTYLHATVSTHRHQVRVPETPMHL-DAILADQVLTGG--LEPRLGQAHLRTLTIMG---F 241

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MI 290
           PS+T PG+ D L    F++      +   K  A  ++GR + Q               M 
Sbjct: 242 PSQTWPGLLDDLNRLAFDYRWVTRAICLDKTDAAKVLGRIRRQWFAKRKSIAAMLKEIMT 301

Query: 291 NAA------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAH 344
           N A      D A+  +DA D AL +L S+         ++ ++ D P+   E L      
Sbjct: 302 NEASALMDSDAANKAVDA-DMALQELGSDLVGAAYVTATVTIWNDDPRIADERLRLVEKV 360

Query: 345 LTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVW 404
           +         E +    AW   LPG+     R   +++ N A + PF +   G      +
Sbjct: 361 IQGRDFTCMVERVNAVEAWLGSLPGHVYANVRQPPVSTLNLAHMMPFSAVWAGPERDEHF 420

Query: 405 GAA-VALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-F 462
            A  + L KT+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++  + +F F
Sbjct: 421 DAPPLFLAKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYARSQIFAF 480

Query: 463 DKDQGAEIFVRAGGGKYKPLKNG------QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTT 516
           D          A  G +  L         +P  + PL G++  E+ + +   WV  ++  
Sbjct: 481 DFGGSIRAAALAMRGDWHDLGGSLAEDASEPVALQPLAGID-AEEERAWAAEWVAAILAR 539

Query: 517 EGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGW 576
           E   +T   ++ +  A+N+L S P ++R+L  L +   +   + +   L+ +  G   G 
Sbjct: 540 EKVEITPDVKEHVWSALNNLASAPKSERTLTGLSVLLQS---QALKQALKPYCVGGPWGR 596

Query: 577 VFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           + D + + +   +  + ++ T+ L        ++ YLF+RI   +DGR  ++++DE W A
Sbjct: 597 LLDAETERVG-SADVLAFE-TEGLIGTGAAAAVLAYLFHRIEHRLDGRPTLLIVDEGWLA 654

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA-- 694
           L+D+ F +  ++ LKT+RK+N  ++FATQS  D   S IA  IIE CPT++F PN++A  
Sbjct: 655 LDDEGFASQLREWLKTLRKKNASVIFATQSLADIDGSAIAPAIIESCPTRLFLPNERALE 714

Query: 695 -NYKDYVEDFKLTEREFELI 713
                  E F L +R+ E++
Sbjct: 715 PQIATIYERFGLNDRQIEIL 734
>rty:RT0771 virB4b; VirB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 810

 Score =  201 bits (512), Expect = 4e-50
 Identities = 180/804 (22%), Positives = 366/804 (45%), Gaps = 65/804 (8%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP   H N++ +      L+ ++ + G+N +    N  N        + ++I D   A 
Sbjct: 20  FIPIACHYNENTLLTKDGKLLQIVKIHGINSEKISDNIQNLREMVRLAIKKHITDYDFAF 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + H IR ++ +   + +     A +   +++K    + + N L++S++ +    + +  +
Sbjct: 80  WLHTIREKQNLDDTTPYKKLLPANIHTLWQRKNHWNDKFVNTLYISIIHDSAKIQIKNFS 139

Query: 133 SFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           S    L+    T  E      A +K+E ++ +++  L  + A  L +      +FS  + 
Sbjct: 140 SLINSLSYKLITNFENTYLDSAFKKLENITNNILDDLNEFGAEKLGIIFENDNVFSN-TL 198

Query: 191 FLHQLVGGRRER---IPLT--FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           FL+  +    +    +P+      +  +IY+   I G +++   H  N +FV +   KEY
Sbjct: 199 FLYNRIANLNDNDCLVPIIDLSNALGRSIYT---ISGDKIVVTDHAKNNKFVSLLSIKEY 255

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRA----SSQID 301
             +T     D  L  P E I+T+ F F SK    +     Q+ ++   + +       I+
Sbjct: 256 -QETPSNTLDKFLQLPIELIITEIFYFVSKKQI-ISKLHGQDHILKITNDSILLNHKGIN 313

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
             DEA  D     F      +S+AV  +    L + ++KA   L   G +  +ED+ +E 
Sbjct: 314 KFDEANVD-----FQFCNQQISIAVIEEDENKLAKAVAKASTELFKLGIIHVKEDINIEQ 368

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
            +W+QLP NF++  R   ++  + A+ +  H+  +G  + N WG A+ LL+T+ G+PY+ 
Sbjct: 369 IFWSQLPANFAFIRRISPLSVEHIASFTALHNTTLGN-QYNPWGRAITLLRTEKGTPYFM 427

Query: 422 NFH-YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY- 479
           NFH   + GNT + G   +GKTV++NFL+++  K+ PT+++   +  ++IF+ A  GK+ 
Sbjct: 428 NFHDKTNKGNTCIFGTEKTGKTVLLNFLISESTKYEPTIIYISNNNDSKIFIEAIEGKWL 487

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLES 538
           +P K      I P   ++ TE+++ F+  + LKL++      ++E E   + K  N + S
Sbjct: 488 EPDKQ----IINPFL-VDDTEQSQAFILEF-LKLISGHYISPLSEIEISFLEKLKNKILS 541

Query: 539 LPHAQRSLGALQLFFDNTSKEGIAI--RLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDM 596
           +   +R    +    +   + GI I  +L+ + +G     +FD    ++  + + IG+++
Sbjct: 542 IEKEKRIFSNILKLANFKEEGGIQIFDKLKVFTEGQLYYGLFDGPSLNIK-EGEVIGFNL 600

Query: 597 TDFLD------------------NEEIRR-----PLMMYLFNRILDLIDGRRIIIVIDEF 633
               D                  N  +++       ++Y  +  L ++  +  I   D F
Sbjct: 601 YTLSDEPFSKQFYPMERKFLEQFNHNLKKHQSISAAVIYALSYNLSILGTKPKIFAADNF 660

Query: 634 WKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTI---IEQCPTQIFFP 690
            +    +S+          + + NG  +F +      L S   +TI   ++   T+I  P
Sbjct: 661 DQLYRPESYYDNINLIYNNLSENNG--IFVSNFNFIYLKSYPKYTIKPWLDLINTKIILP 718

Query: 691 NQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILS 750
           +     +D  +   L+E E   + S+L   +R FLI +   S+ +EL++  +   + ILS
Sbjct: 719 SD-VKIEDLDKILGLSELEIRKL-SQLILSARMFLINKDNESIASELSIAALIGIVRILS 776

Query: 751 GTTKNIELVNQIINDYGADPDTWL 774
              + +++  +I+ ++   PD W+
Sbjct: 777 SRQEEMDIYKKILQEHNGPPDNWI 800
>rbe:RBE_0080 virB4-2; VirB4; K03199 type IV secretion system protein VirB4
          Length = 807

 Score =  201 bits (510), Expect = 7e-50
 Identities = 175/791 (22%), Positives = 337/791 (42%), Gaps = 42/791 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP   H N+H +      L+ ++ V G++ +       N       ++ ++      A 
Sbjct: 20  FIPIACHYNEHTLLTKDGKLLQIIKVYGISSEKISDKIQNLREIIRASVKKHTNSYDFAF 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + H IR ++ +   + +     A +   +++K    + + N L++S++ +    K +   
Sbjct: 80  WMHTIREKQNLDDPTPYKKLLPANIHALWQRKNHWNDKFVNTLYISIVHDSAKIKIKNFG 139

Query: 133 SFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           S    L+       E      A++K+E L+ +++  L  ++A  L +       FS    
Sbjct: 140 SLINSLSTKLIVDFENKYLESAVQKLESLANNILNDLNEFDAEKLGITFENENTFSAPLF 199

Query: 191 FLHQLVGGRRERIPLTFGTIASTI-YSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
             +++         +    ++S I  S   I G +MI    E N++F+ +   KEY    
Sbjct: 200 LYNRIANINDSDCLVPIIDLSSAIGRSTYTISGDKMIVTNQEQNKKFISLLSIKEYQESP 259

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
              + D  L  P E I+T+ F F  K      +  +   +    D    +   +++  D+
Sbjct: 260 SEAL-DKFLQLPLELIITEIFYFVDKKVVTAALKGQDYILKITNDNNLIEHKGINKLNDN 318

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
             S  F      +S+AV  +    L   ++KA   L   G V  +EDL +E  +WAQLP 
Sbjct: 319 KSSFEFC--NQQISIAVIEEDEDKLTASVAKAARELFKLGIVHVKEDLNIEQTFWAQLPA 376

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFH-YGDL 428
           NF++  R   + S + A+L+  H+ P+G  +   WG A+ LL+T+ G+PY+ NFH     
Sbjct: 377 NFAFIRRMSPLLSDHIASLAALHNSPLGS-QYTSWGRALTLLRTERGTPYFMNFHDKTGR 435

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPT 488
           GNT + G   +GKTV++NFL+++  K++PT+++      ++IF+ A  G +  +      
Sbjct: 436 GNTCIFGTEKTGKTVLLNFLVSESTKYDPTIIYISNSNDSKIFIEALEGTWLEI---DKQ 492

Query: 489 GIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGA 548
            I P   ++ TEK++ F+  ++  L       + E E   + K  + + S+   +R    
Sbjct: 493 IINPFL-VDDTEKSQAFILEFLKMLSGHYISPLNEVELTFLEKLRSKILSIDKEKRIFSD 551

Query: 549 LQLFFDNTSKEGIAI--RLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLD----- 601
           +    D   + G  I  +L+ + +G     +FD    ++N +S  +G ++    D     
Sbjct: 552 ILKLEDFKEEGGSTILDKLKGFTEGQLYSGLFDQSVFNIN-ESSIVGLNLYKLSDEPFAK 610

Query: 602 -------------NEEIRR-----PLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFK 643
                        N  +++       ++Y     L L+  +  I   D F K  + + + 
Sbjct: 611 QFYPSERKYLEQFNNNLKKHQSVCASVVYALTYHLSLVGTKPKIFAADSFDKLYKPEIYS 670

Query: 644 AFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDF 703
                    + + NG  +F        L        +E   T+I  P+     +D  E  
Sbjct: 671 DNISLIFNNLSENNG--VFVGNFNFIYLKKYTLKAWLEIINTKIILPSD-VKIEDLDEIL 727

Query: 704 KLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQII 763
            LT+ E   + S+L   SR FLI +   S+  EL++  +   + ILS   + + +  +++
Sbjct: 728 GLTDSEIRKL-SQLILTSRMFLINKDNESIALELSIAALVGVVRILSSKKEEMAIYKEVL 786

Query: 764 NDYGADPDTWL 774
             Y   PD W+
Sbjct: 787 EKYQGPPDNWI 797
>mes:Meso_3854 ATPas
          Length = 830

 Score =  200 bits (509), Expect = 1e-49
 Identities = 175/737 (23%), Positives = 329/737 (44%), Gaps = 57/737 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +Y+P+   V   V+              G + D+A    L     +LN  LR +     A
Sbjct: 16  DYLPWAALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVGTTARLNNALRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R + T YP+S+F  + +A +D + +++  ++ + + +  F++ LW P + +  +
Sbjct: 75  VFVEAQRVQATHYPDSQFPDAASALIDVERREQFEAEGVHFESRYFLTFLWMPPAEEASR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
             S+   L + K        E +    + +  ++Q +E +   +      + +   E   
Sbjct: 135 AESW---LYEGKARTGVDPWELLAGFVDRTDRILQLVEGFVPEV------DWLDDGETLT 185

Query: 191 FLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPSKT 249
           +LH  V  RR+R+ +      + +Y D ++  + +   +     E  +       +P+ T
Sbjct: 186 YLHSTVSTRRQRVRVP----EAPMYLDAILVDEPLAGGLEPRLGEHHLRTLTVTGFPTAT 241

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINAA- 293
            PG+ D L    FE+  +   +   K  A  ++ R + Q               M N A 
Sbjct: 242 FPGILDELNRLAFEYRWSTRAILLDKTDATKLLTRIRRQWFAKRKSVAAIVKEVMTNEAS 301

Query: 294 -----DRASSQIDALDEALDDLESNRFVLGEHHLS--LAVFADQPKTLVEYLSKARAHLT 346
                D A+   DA D AL +L S+   +GE +++  + V+   P   VE L      + 
Sbjct: 302 TLLDSDAANKAFDA-DMALQELGSDD--VGEAYVTATVTVWDRDPAIAVEKLRLVEKIIQ 358

Query: 347 NGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA 406
                   E +    AW   LPG      R   +++ N A + P  +   G    +  GA
Sbjct: 359 ARDFTSIPETINAIEAWLGSLPGQPYANVRQPPVSTLNIAHMVPLSAVWAGPERNDHLGA 418

Query: 407 AVALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDK 464
              L  +T+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++    +F FD 
Sbjct: 419 PPLLYGRTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYTNNQIFAFDF 478

Query: 465 DQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGME-----YTEKNKIFLRSWVLKLVTTEGQ 519
                I   A GG +  L  G   G      ++     +    + +   W++ ++  EG 
Sbjct: 479 GGSIRIAALAMGGDWHDLGGGLSDGADATVSLQPLARIHDVPERAWAADWIVSILGREGV 538

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFD 579
            +T + ++ +  A+ SL S P  +R++  L +   +     +   L+ +  G   G + D
Sbjct: 539 QITPEVKEHLWSALTSLASAPVDERTITGLSVLLQSNE---LKRALRPYCVGGPWGRLLD 595

Query: 580 NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALED 639
            +++ L   S  +    T+ L        ++ YLF+RI   +DGR  +++IDE W AL+D
Sbjct: 596 AEREHLGEGS--VQAFETEGLVGTGAASAVLTYLFHRIEGRLDGRPTLLIIDEGWLALDD 653

Query: 640 DSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDY 699
           ++F    ++ LKT+RK+N  ++FATQS  D  +S IA  I+E CPT++F PN++A     
Sbjct: 654 ENFADQLREWLKTLRKKNAAVIFATQSLSDIGDSAIAAAIVESCPTRLFLPNERAIEPQI 713

Query: 700 V---EDFKLTEREFELI 713
           +     F L +R+ E++
Sbjct: 714 LAIYRKFGLNDRQIEIL 730
>rpr:RP784 virB4; virB4 protein precursor; K03199 type IV secretion system
           protein VirB4
          Length = 810

 Score =  199 bits (506), Expect = 2e-49
 Identities = 182/805 (22%), Positives = 367/805 (45%), Gaps = 67/805 (8%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP   H N++ +      L+ ++ + G+N +    N  N        + +++ D   A 
Sbjct: 20  FIPIACHYNENTLLTKDGKLLQIVKIHGINSEKISDNIQNLREMVRLAIKKHVTDYDFAF 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           + H IR ++ +   + +     A +   +++K    + + N L++S++ +    + +  +
Sbjct: 80  WLHTIREKQNLDDITPYKKLLPANIHTLWQRKNHWNDKFVNTLYISIVHDSAKIQIKNFS 139

Query: 133 SFFQRLTKAKKTQSEPDM--EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           S    L+       E +    A +K+E ++ +++  L  + A  L +      +FS  + 
Sbjct: 140 SLINSLSYKLIANFEKNYLDSAFKKLENITNNILNDLNEFGAEKLGIIFENDNVFSN-TL 198

Query: 191 FLHQLVGGRRER---IPLT--FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           FL+  +    +    +P+      +  +IY+   I G ++I   H  N +FV +   KEY
Sbjct: 199 FLYNRIANLNDNDCLVPIIDLSDALGRSIYT---ISGDKIIVTDHAKNNKFVSLLSIKEY 255

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRAS----SQID 301
             +T     D  L  P E I+T+ F F SK    +     Q+ ++   + +       I+
Sbjct: 256 -QETPSNTLDKFLQLPIELIITEIFYFVSKKQI-ISKLHGQDHILKITNDSILLNYKGIN 313

Query: 302 ALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEA 361
            LDE   D     F      +S+AV  +    L + ++KA   L   G +  +ED+ +E 
Sbjct: 314 KLDETNLD-----FQFCNQQISIAVIEEDESKLAKAVAKASTELFKLGIIHVKEDINIEQ 368

Query: 362 AWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYF 421
            +W+QLP NFS+  R   ++  + A+ +  H+  +G  + N WG A+ LL+T+ G+PY+ 
Sbjct: 369 IFWSQLPANFSFIRRISPLSVEHIASFTALHNTTLGN-QYNPWGRAITLLRTEKGTPYFM 427

Query: 422 NFH-YGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKY- 479
           NFH   + GNT + G   +GKTV++NFL+++  K++PT+++   +  ++IF+ A  GK+ 
Sbjct: 428 NFHDKTNKGNTCIFGTEKTGKTVLLNFLISESTKYDPTIIYISNNNDSQIFIEAIEGKWL 487

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLES 538
           +P K      I P   ++ TE+++ F+  + LKL++      ++E E   + K  + + S
Sbjct: 488 EPEKQ----IINPFL-VDDTEQSQAFILEF-LKLISGHYISQLSEIEISFLEKFKDKILS 541

Query: 539 LPHAQRSLGALQLFFDNTSKEG---IAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYD 595
           +   +R    + L  +N  +EG   I  +L+ + +G     +FD     +  + + IG++
Sbjct: 542 IEKEKRIFSNI-LKLENFKEEGGIQIFDKLKVFTEGQLYYGLFDGPSLSIK-EGEVIGFN 599

Query: 596 MTDFLD------------------NEEIRR-----PLMMYLFNRILDLIDGRRIIIVIDE 632
           +    D                  N  +++       ++Y  +  L L+  +  I   D 
Sbjct: 600 LYTLSDEPFSKQFYPMERKFLEQFNHNLKKHQSISAAVIYALSYHLSLLGTKPKIFAADN 659

Query: 633 FWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTI---IEQCPTQIFF 689
           F +    +S+          + + NG  +F +      L S   +TI   ++   T+I  
Sbjct: 660 FDQLYRPESYYDNINLIYNNLSENNG--IFVSNFNFIYLKSYPKYTIKPWLDLINTKIIL 717

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           P+     +D  +   L E E   + S+L   +R FLI +   S+ +EL++  +   + IL
Sbjct: 718 PSD-VKIEDLDKILGLNELEIRKL-SQLMLAARMFLINKDNESIASELSIAALIGIVRIL 775

Query: 750 SGTTKNIELVNQIINDYGADPDTWL 774
           S   + +++  +I+ ++   PD W+
Sbjct: 776 SSRQEEMDIYKKILQEHAGPPDNWI 800
>hpa:HPAG1_0519 cag pathogenicity island protein E
          Length = 438

 Score =  197 bits (500), Expect = 1e-48
 Identities = 142/415 (34%), Positives = 203/415 (48%), Gaps = 48/415 (11%)

Query: 397 GKLEGNVWGAAVALLKTQAGSPYYFNFHY------GDLGNTFVCGPSGSGKTVIVNFLLA 450
           G  E N WG +V  LK++  SP+Y NFH          G+T + G +GSGKTV ++  L 
Sbjct: 8   GNQENNAWGNSVMTLKSEINSPFYLNFHMPTDFGSASAGHTLILGSTGSGKTVFMSMTLN 67

Query: 451 QL-------------QKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGME 497
            +              K   TMV+ DKD GA   + A GG+Y  ++ G  TG+ P     
Sbjct: 68  AMGQFVHNFPANVSKDKQKLTMVYMDKDYGAYGNIVAMGGEYVKIELGTDTGLNPFAWAA 127

Query: 498 YTEKNKIFLR------SWVLKLVTTEGQTVTEQERQ--DIAKAINSLESLPHAQRSL--G 547
             +K    +       S V +LV        E++     I+ ++    +L  A  +L  G
Sbjct: 128 CVQKTNATMEQKQTAISVVKELVKNLATKSDEKDENGNSISFSLADSNTLAAAVTNLITG 187

Query: 548 ALQLFF-----------DNTSKEGIAIRLQRWIKGN--DLGWVFDNDQDD-LNLDSQFIG 593
            + L +           D+    G+  RL  + K    +  W+FDN   D L+     IG
Sbjct: 188 DMNLDYPITQLINAFGKDHNDPNGLVARLAPFCKSTNGEFQWLFDNKATDRLDFSKTIIG 247

Query: 594 YDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTI 653
            D + FLDN ++   +  YLF RI + +DGRR ++ IDE WK L D     F +D LKT 
Sbjct: 248 VDGSSFLDNNDVSPFICFYLFARIQEAMDGRRFVLDIDEAWKYLGDPKVAYFVRDMLKTA 307

Query: 654 RKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELI 713
           RK+N ++  ATQS  D L   IA TI EQCPT+IF  N   N  DY     +TE+EFE+I
Sbjct: 308 RKRNAIVRLATQSITDLLACPIADTIREQCPTKIFLRNDGGNLSDYQRLANVTEKEFEII 367

Query: 714 QSELSRESRRFLIKQ-GQNSVVAELNLRGMNDE-IAILSGTTKNIELVNQIINDY 766
              L    R+ L KQ G  SV+A  NLRG+  E + ILS  T  ++ +++II ++
Sbjct: 368 TKGL---DRKILYKQDGSPSVIASFNLRGIPKEYLKILSTDTVFVKEIDKIIQNH 419
>rpc:RPC_3538 ATPase
          Length = 813

 Score =  193 bits (491), Expect = 1e-47
 Identities = 181/793 (22%), Positives = 354/793 (44%), Gaps = 59/793 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V++ ++              G + D+A    L ++ ++LN  LR       A
Sbjct: 16  DFLPWAALVDEGIVLNKDGSFQRTAQFRGPDLDSAVPAELAAVASRLNNALRRFGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YP S F    +A +D + + +   +   Y +  F++ L+ P    T +
Sbjct: 75  VFVEAQRYPANKYPVSHFPDVASALVDVERRAEFEREGAHYESGYFLTFLYLPPPEDTAR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGL-ESYEARLLSVYAHEGILFSEQS 189
              F   L + +  + + D   +++      D + GL E +   L  +   E + +    
Sbjct: 135 TEKF---LYEGRDRRHDEDARQVQRGFVDRTDRVLGLVEGFMPELKWLDDEETLTY---- 187

Query: 190 EFLHQLVGGRRERIPLT-FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
             LH  V  +R+R+ +         + +D+ + G  +  +  +S+ R + + G   +P+ 
Sbjct: 188 --LHSTVSTKRQRVRVPEIPMYLDALLADQPLTGG-LEPMLGQSHLRVLTVVG---FPTV 241

Query: 249 TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINAA 293
           T PG+ D L    F +      +   K  A  ++ + + Q               M N A
Sbjct: 242 TTPGILDELNRLAFAYRWATRAIMLDKTDATRLLTKIRRQWFAKRKSIAAILKEVMTNEA 301

Query: 294 ------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTN 347
                 D  +  +DA D AL +L S+         ++ V+ D P+   E L      +  
Sbjct: 302 STLLDSDAHNKALDA-DAALQELGSDAIGQAFVTATVTVWDDDPRVADEKLRLVEKVIQG 360

Query: 348 GGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA- 406
                  E +    AW   LPG+     R   +++ N A + P  +   G      +GA 
Sbjct: 361 RDFTCMVESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPARDEHFGAP 420

Query: 407 AVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKD 465
           A+   +T+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++    +F FD  
Sbjct: 421 ALFFGRTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYPHNQIFAFDFG 480

Query: 466 QGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEK-----NKIFLRSWVLKLVTTEGQT 520
                   A GG +  L      G +    ++   +      + +   W++K+++ EG T
Sbjct: 481 GSIRAAALAMGGDWHDLGGDLTDGASSSLSLQPLSRIPDVPERAWAADWIVKILSREGIT 540

Query: 521 VTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDN 580
            T + ++ +  A++SL S P  +R++  L +       + +   LQ +  G   G + D 
Sbjct: 541 TTPEVKEHLWSALSSLASAPDTERTMTGLSVLLQ---AQALKRALQPYCIGGASGRLLDA 597

Query: 581 DQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDD 640
           + + L  D+    ++ T+ L        ++ YLF+RI   +DGR  +++IDE W AL+D+
Sbjct: 598 ETERLG-DAPVQVFE-TEGLIGTAAAPAVLAYLFHRIEHRLDGRPTLLIIDEGWLALDDE 655

Query: 641 SFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NYK 697
            F    ++ LKT+RK+N  ++FATQS  D  NS IA  IIE CPT++  PN++A      
Sbjct: 656 GFAGQVREWLKTLRKKNASVVFATQSLSDIDNSAIAPAIIESCPTRLLLPNERAIEPQIS 715

Query: 698 DYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTK-NI 756
              + F L +R+ E++    +   R +  +  + + + EL L  +   +A+ + ++K + 
Sbjct: 716 AVYQRFGLNDRQIEILAR--ATPKRDYYCQSRRGNRLFELGLGAI--ALALCAASSKADQ 771

Query: 757 ELVNQIINDYGAD 769
            ++ +++ ++G D
Sbjct: 772 AMIARVLAEHGRD 784
>mes:Meso_0506 ATPas
          Length = 812

 Score =  192 bits (489), Expect = 2e-47
 Identities = 186/795 (23%), Positives = 346/795 (43%), Gaps = 64/795 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V + V+              G + D+A    L ++ ++LN   R +     A
Sbjct: 16  DFLPWAALVGEGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVASRLNNAFRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YP SRF  + +A +D + K      +  Y +  F++ L+ P +   E 
Sbjct: 75  IFVEAQRHEAASYPASRFADAASALVDAERKADFEEADAHYESSYFLTFLYLPPA---ED 131

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY--EARLLSVYAHEGILFSEQ 188
            A     L + ++       EA+    + +  ++Q ++ +  E R L          +E 
Sbjct: 132 AARAETWLYEGRQQSGVDPHEALAAFIDRTNRVLQLVDGFMPECRWLDD--------AET 183

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPS 247
             +LH  V  +R R+ +      + IY D ++  + +   +        + +     +P+
Sbjct: 184 LTYLHSTVSTKRHRVRVP----ETPIYLDALLAVEPLTGGLEPRLGAAHLRVLTINGFPT 239

Query: 248 KTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINA 292
            T PG+ D L    F +  +   +   K  A  ++ R + Q               M N 
Sbjct: 240 ATTPGILDDLNRLAFPYRWSTRAILLDKTDATKLLTRIRRQWFAKRKSIAAILKEVMTNE 299

Query: 293 A------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLT 346
           A      D A+   DA D AL +L ++         ++ V+   P+T  E L      + 
Sbjct: 300 ASALVDTDAANKAADA-DMALQELGADYAGQAYVTATVTVWDADPRTADEKLRLVEKVIQ 358

Query: 347 NGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA 406
                   E +    AW   LPG+     R   I++ N A + P  +   G      +GA
Sbjct: 359 GRDFTAMSETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGA 418

Query: 407 AVALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDK 464
              L  KT+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++  + VF FD 
Sbjct: 419 PPLLYGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALIALQFRRYPGSQVFAFDF 478

Query: 465 DQGAEIFVRAGGGKYKPLKNGQPTGIA------PLKGMEYTEKNKIFLRSWVLKLVTTEG 518
                    A GG +  L      G A      PL  +  T + + +   W+  ++  E 
Sbjct: 479 GGSIRAAALAMGGDWHDLGGSLTDGAASSVSLQPLARVHETHE-RAWAADWIAAILARES 537

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVF 578
            T+T + ++ +  A+ SL S P  +R+L  L +   +     +   L+ +  G   G + 
Sbjct: 538 VTITPEVKEHLWTALTSLASAPITERTLTGLAVLLQSND---LKQALRPFCVGGAYGRLL 594

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE 638
           D + + L  ++    ++ T+ L        ++ YLF+RI D +DGR  ++++DE W AL+
Sbjct: 595 DAEGEQLG-EAAVQAFE-TEGLIGGGAAPAVLAYLFHRIGDRLDGRPTLLIVDEGWLALD 652

Query: 639 DDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---N 695
           D+ F A  ++ LKT+RK+N  ++FATQS  D   S IA  IIE C T++  PN++A    
Sbjct: 653 DEGFAAQLREWLKTLRKKNASVVFATQSLADIDGSAIAPAIIESCQTRLLLPNERAIEPQ 712

Query: 696 YKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKN 755
                  F L +R+ E++    +   R +  +  + + + EL L  +   +A+ + ++K 
Sbjct: 713 ITTIYRRFGLNDRQIEILSR--ATPKRDYYCQSRRGNRLFELGLSEV--ALALCAASSKT 768

Query: 756 IE-LVNQIINDYGAD 769
            +  +  I+ ++G D
Sbjct: 769 DQAAIEAILAEHGRD 783
>bam:Bamb_2007 AAA ATPase
          Length = 816

 Score =  192 bits (488), Expect = 3e-47
 Identities = 178/739 (24%), Positives = 314/739 (42%), Gaps = 52/739 (7%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +R +L  +++P+   +   V+              G + D+A    L +   +LN  LR 
Sbjct: 9   QRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRR 68

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMV-SQELYRNDLFVSLLWNP 123
           +     AL+    RR    YP S F    +  +DE+ +     S   + +   ++L   P
Sbjct: 69  LGSGW-ALFIEAERRPAADYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYHLTLAHLP 127

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
                 + A                 ++A     +   DL+ G+    ARL         
Sbjct: 128 PEESRARAAKLLYENAPGDGVDWHGRLDAFVAETDRVFDLLDGVMPEIARLDD------- 180

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFVGMFGW 242
             ++   +LH  V  RR R+    G      + D ++    ++  +     ++ + +   
Sbjct: 181 --AQTLTYLHATVSTRRYRV----GVPEVPFHIDALLADSALVGGLAPTLGDQHLRVVSV 234

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR------------------ 284
           + +P+ T PG+ D L    F +  +  F+   KA A   +GR                  
Sbjct: 235 RGFPTSTWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQWFAKRKNVVALLRE 294

Query: 285 ---KQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
              +Q   +   D ++   DA D A+ +L  ++   G    ++ V         E L   
Sbjct: 295 TIFQQESPLVDTDASNKAADA-DAAMQELGGDQVAFGYFTATVTVLDADSAAADEKLRMV 353

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLE 400
              +   G V   E L +  AW + +PGN     R   +++ N A + P  +   G +  
Sbjct: 354 ERVIQGRGFVTIPETLNVVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPEKN 413

Query: 401 GNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
            ++ G  + + +T   +P+    H GD+G+T V GP+G GK+V++  L+ Q +++  + V
Sbjct: 414 DHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILVQQFRRYRGSRV 473

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIA--PLKGMEYTEKNKIFLRSWVLKLVTTE 517
           F FD  +     +   GG++  L  G   GIA  PL  ++  E  + +   WV   +  E
Sbjct: 474 FAFDMGRSMRATILGLGGEHYDL--GADGGIAFQPLARID-RESYRSWAGEWVEGRLLHE 530

Query: 518 GQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWV 577
           G TV   E+  I  A+ SL   P  QR+L  L +   + +   +   L  ++ G   G +
Sbjct: 531 GVTVGPDEKAVIWSALGSLTGAPVEQRTLTGLSVLLQSNA---LRQALAPYVLGGAHGKL 587

Query: 578 FDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKAL 637
            D D D L       G++M + + +    + ++ YLF R  +  DG   ++++DE W  L
Sbjct: 588 LDADTDRLGF-GDVQGFEMEELMHSPAAVQAVLRYLFARFDERFDGAPTLLILDEAWLFL 646

Query: 638 EDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA--- 694
           ++ SF A  +  LKT+RK+N  ++FATQS  D  +S+IA  IIE CP++IF PN +A   
Sbjct: 647 DEPSFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCPSRIFLPNPQATEP 706

Query: 695 NYKDYVEDFKLTEREFELI 713
             +   E F L  R+ E++
Sbjct: 707 QIRTIYEGFGLNSRQIEIV 725
>rme:Rmet_1344 ATPase
          Length = 819

 Score =  190 bits (482), Expect = 1e-46
 Identities = 177/738 (23%), Positives = 312/738 (42%), Gaps = 50/738 (6%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +R +L  +++P+   V   V+              G + D+A    L +   +LN  LR 
Sbjct: 9   QRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRR 68

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMV-SQELYRNDLFVSLLWNP 123
           +     AL+    RR    YP S F    +  +DE+ +     S   + +   ++L++ P
Sbjct: 69  MGSGW-ALFIEAERRPAADYPHSEFPEPLSWLVDEERRATFEDSGNHFESGYHLTLVYLP 127

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
                 + A      T          ++A     +   DL+ G+      L         
Sbjct: 128 PEESRARAAKMLYENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEITWLDD------- 180

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTI-ASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             S+   +LH  +  RR R+ +         + +D  + G  +  +  + + R V + G 
Sbjct: 181 --SQTLTYLHATISTRRYRVGVPEVPFHIDALLTDSALVGG-LAPMLGDQHLRVVSVRG- 236

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR------------------ 284
             +P+ T PG+ D L    F +  +  F+   KA A   +GR                  
Sbjct: 237 --FPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAERELGRLRRQWFAKRKNVIALLRE 294

Query: 285 ---KQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
              +Q   +   D ++   DA D AL +L S++   G    ++ V    P    E L   
Sbjct: 295 TIFQQESPLVDTDASNKAADA-DAALQELGSDQVAFGYLTATVTVLDADPAVADEKLRMV 353

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLE 400
              +   G +   E L    AW + +PGN     R   +++ N A + P  +   G + +
Sbjct: 354 ERVIQGRGFITIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKD 413

Query: 401 GNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
            ++ G  + + +T   +P+    H GD+G+T V GP+G GK+V++  L  Q +++  + +
Sbjct: 414 EHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRI 473

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ 519
           F FD  +     V   GG++  L         PL  ++  E  + +   W+   +  EG 
Sbjct: 474 FAFDMGRSMRATVLGLGGEHYDLGTDGEIAFQPLAHID-REGYRTWAAEWIEGRLLHEGV 532

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFD-NTSKEGIAIRLQRWIKGNDLGWVF 578
            V   E+  I  A+ SL   P  QR++  L +    NT ++     L  ++ G   G + 
Sbjct: 533 AVGPDEKAAIWSALGSLAGAPLEQRTMTGLSVLLQSNTLRQA----LSPYVLGGAHGKLL 588

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE 638
           D D D L + +    ++M + + N+     ++ YLF R  +  DG   ++++DE W  L+
Sbjct: 589 DADHDRLGM-ADVQCFEMEELMHNKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLD 647

Query: 639 DDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---N 695
           D  F A  +  LKT+RK+N  ++FATQS  D  +S+IA  IIE C ++IF PN +A    
Sbjct: 648 DPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQ 707

Query: 696 YKDYVEDFKLTEREFELI 713
            +   E F L  R+ E++
Sbjct: 708 IRTIYEGFGLNSRQIEIV 725
>mes:Meso_2321 ATPas
          Length = 811

 Score =  189 bits (480), Expect = 2e-46
 Identities = 169/717 (23%), Positives = 319/717 (44%), Gaps = 58/717 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V + V+              G + D+A    L ++ ++LN + R +     A
Sbjct: 15  DFLPWAALVGEGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVASRLNNVFRRLGSGW-A 73

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YPESRF  + +A +D + K         Y +  F++ L+ P +    +
Sbjct: 74  IFVEAQRHEAATYPESRFPDAASALVDAERKADFEEAGAHYESSYFLTFLYLPPAEDAAR 133

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
             S+   L + ++       E++    + +  ++  L+ +      + A   +  SE   
Sbjct: 134 AESW---LYEGREQTGVNPHESLAAFVDRTDRVLALLDGF------MPACRWLDDSETLT 184

Query: 191 FLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEM---IEIR-HESNERFVGMFGWKEYP 246
           FLH  +  RR R+ +      + +Y D ++  + +   +E R  + + R + + G   +P
Sbjct: 185 FLHSTISTRRHRVRVP----ETPMYLDALLADQPLTGGLEPRLGDQHLRILTIVG---FP 237

Query: 247 SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MIN 291
           + T PG+ D L    F +  +   +   K  A  ++ + + Q               M N
Sbjct: 238 TATTPGILDELNRLAFPYRWSTRAILLDKVDATKLLTKIRRQWFAKRKSIAAILKEVMTN 297

Query: 292 AA------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHL 345
            A      D A+   DA D AL +L ++         ++ V+   P+   E L      +
Sbjct: 298 EASALVDTDAANKAADA-DMALQELGADYAGQAYVTATVTVWDGDPRIADEKLRLVEKVI 356

Query: 346 TNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG 405
                    E +    AW   LPG+     R   +++ N A + P  +   G      +G
Sbjct: 357 QGRDFTAMPETINAVDAWLGSLPGHVYANVRQPPVSTLNLAHMIPLSAVWAGPERDEHFG 416

Query: 406 AAVALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FD 463
           A   L  KT+  + +  + H GD+G+T V GP+G+GK+V++  +  Q +++  + +F FD
Sbjct: 417 APPLLYGKTEGSTTFRLSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQIFAFD 476

Query: 464 KDQGAEIFVRAGGGKYKPLKNGQPTG------IAPLKGMEYTEKNKIFLRSWVLKLVTTE 517
                     A GG +  L  G   G      + PL  + YT + + +   W++ ++  E
Sbjct: 477 FGGSIRAAALAMGGNWHDLGGGLSEGTETSVSLQPLARIHYTSE-RAWAADWIVAILMRE 535

Query: 518 GQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWV 577
           G ++T + ++ +  A+ SL S P  +R++  L +   +     +   L+ +  G   G +
Sbjct: 536 GVSITPEVKEHLWAALTSLASAPLDERTITGLAVLLQSND---LKQALRPYCVGGPYGRL 592

Query: 578 FDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKAL 637
            D + +  +L S  +    T+ L        ++ YLF+RI D +DG   ++++DE W AL
Sbjct: 593 LDAESE--HLGSATVQAFETEGLIGTGAAPAVLSYLFHRIGDRLDGSPTLLIVDEGWLAL 650

Query: 638 EDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA 694
           +D+ F    ++ LKT+RK+N  ++FATQS  D  +S IA  IIE CPT++  PN++A
Sbjct: 651 DDEGFAGQLREWLKTLRKKNASVVFATQSLSDIDDSKIAPAIIESCPTRLLLPNERA 707
>rpa:RPA4121 trbE2; conjugal transfer protein trbE; K03199 type IV secretion
           system protein VirB4
          Length = 813

 Score =  188 bits (478), Expect = 4e-46
 Identities = 173/736 (23%), Positives = 322/736 (43%), Gaps = 54/736 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V++ ++              G + D+A    L  + ++LN  LR       A
Sbjct: 16  DFLPWAALVDEGIVLNKDGSFQRTAQFRGPDLDSAVPAELAGVASRLNNALRRFGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YPE  F    +A +D + + +   +   Y +  F++ L+ P    T +
Sbjct: 75  VFVEAQRYPANKYPEGHFPDVASALVDVERRAEFEREGAHYESGYFLTFLYLPPPEDTAR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGL-ESYEARLLSVYAHEGILFSEQS 189
              F   L + +  + + D   +++      D + GL E +   L  +   E + +    
Sbjct: 135 TERF---LYEGRDRRHDEDARQVQRGFVDRTDRVLGLVEGFMPELKWLDDEETLTY---- 187

Query: 190 EFLHQLVGGRRERIPLT-FGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
             LH  V  +R+R+ +         + +D+ + G  +  +  +S+ R + + G   +P+ 
Sbjct: 188 --LHSTVSTKRQRVRVPEIPMYLDALLADQPLTGG-LEPMLGQSHLRVLTVVG---FPTV 241

Query: 249 TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINAA 293
           T PG+ D L    F +      +   K  A  ++ + + Q               M N A
Sbjct: 242 TTPGILDELNRLAFAYRWATRAIMLDKTDATRLLTKIRRQWFAKRKSIAAILKEVMTNEA 301

Query: 294 ------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTN 347
                 D  +  +DA D AL +L S+         ++ V+ D P+   E L      +  
Sbjct: 302 STLLDSDAHNKALDA-DAALQELGSDAIGQAFVTATVTVWDDDPRIADEKLRLVEKVIQG 360

Query: 348 GGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA- 406
                  E +    AW   LPG+     R   +++ N A + P  +   G       GA 
Sbjct: 361 RDFTCMVESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPARDEHLGAP 420

Query: 407 AVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKD 465
           A+   +T+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++    +F FD  
Sbjct: 421 ALFFGRTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYPHNQIFAFDFG 480

Query: 466 QGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEK-----NKIFLRSWVLKLVTTEGQT 520
                   A GG +  L      G +    ++   +      + +   W++ +++ EG T
Sbjct: 481 GSIRAAALAMGGDWHDLGGDLTDGASSSLSLQPLSRIPDVPERAWAADWIVNILSREGIT 540

Query: 521 VTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDN 580
            T + ++ +  A+ SL S P  +R+L  L +       + +   LQ +  G   G + D 
Sbjct: 541 TTPEVKEHLWSALTSLASAPDTERTLTGLSVLLQ---AQALKRALQPYCIGGASGRLLDA 597

Query: 581 DQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDD 640
           + + L  D+    ++ T+ L        ++ YLF+RI   +DGR  +++IDE W AL+D+
Sbjct: 598 ETERLG-DAPVQVFE-TEGLIGTAAAPAVLAYLFHRIEHRLDGRPTLLIIDEGWLALDDE 655

Query: 641 SFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NYK 697
            F    ++ LKT+RK+N  ++FATQS  D  NS IA  IIE CPT++  PN++A      
Sbjct: 656 GFAGQVREWLKTLRKKNASVVFATQSLSDIDNSEIAPAIIESCPTRLLLPNERAIEPQIS 715

Query: 698 DYVEDFKLTEREFELI 713
              + F L +R+ E++
Sbjct: 716 AVYQRFGLNDRQIEIL 731
>mlo:mll9608 conjugal transfer protein trbE; K03199 type IV secretion system
           protein VirB4
          Length = 816

 Score =  187 bits (475), Expect = 9e-46
 Identities = 180/794 (22%), Positives = 346/794 (43%), Gaps = 62/794 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +Y+P++  V   V+              G + D+A    L +  +++N   R +     +
Sbjct: 16  DYLPWVALVAPGVVLNKDGSFQRTARFRGPDLDSAVAAELVAAASRINNAFRRLGSGW-S 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YPES+F ++ +  LD + K       + + +  F++ L+ P      +
Sbjct: 75  IFVEAQRHEAASYPESQFPNAASGLLDAERKADFDEAGVHFVSSYFLTFLFLPPPEDATR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
              +F    + +        E +R   + +  ++  L+            + +   +   
Sbjct: 135 AEGWFY---EGRDHAGADPGEIVRAFTDRTGRVLALLDGLMPEC------QWLDDEDTLT 185

Query: 191 FLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPSKT 249
           +LH  +  +R R+ +      + IY D ++  + +   +     ++ + +     +P+ T
Sbjct: 186 YLHSTISTKRHRVRVP----ETPIYLDALLADQPLAGGLEPRLGDKHLRVLSIVGFPTAT 241

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINAA- 293
            PG+ D L    F +  +   +   K  A  ++ R + Q               M N A 
Sbjct: 242 TPGLLDDLNRLAFPYRWSTRAILLDKPDAVRLLNRIRRQWFAKRKSIAAILKEVMTNEAS 301

Query: 294 -----DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNG 348
                D A+   DA D AL +L ++   +     S+AV+   P+   E L      +   
Sbjct: 302 ALLDTDAANKAADA-DTALQELGADMVGMAYVTASVAVWDSDPRVADEKLRLVEKVIQGR 360

Query: 349 GAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLEGNVWGAA 407
                 E +    AW   LPG+     R   I++ N A + P  +   G + + ++ G  
Sbjct: 361 DFTAIAETVNAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHLVGPP 420

Query: 408 VALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKDQ 466
           +   KT+  +P+    H GD+G+T V GP+G+GK+V++  +  Q  +++   +F FD   
Sbjct: 421 LLYGKTEGSTPFRLVLHVGDVGHTLVVGPTGAGKSVLLALMALQFCRYHNAQIFAFDFGG 480

Query: 467 GAEIFVRAGGGKYKPLKNGQPTG------IAPLKGMEYTEKNKIFLRSWVLKLVTTEGQT 520
                  + GG +  L      G      + PL  +  T + + +   W++ L+  EG  
Sbjct: 481 SIRAAAFSMGGDWHDLGGHLTEGMDASVSLQPLARIHDTYE-RAWAADWIVALLMREGIQ 539

Query: 521 VTEQERQDIAKAINSLESLPHAQRSLGALQLFFD-NTSKEGIAIRLQRWIKGNDLGWVFD 579
           +T   ++ I  A+ SL S P  +R+L  L +    N  K+     L+ +  G   G + D
Sbjct: 540 ITPDAKEHIWAALTSLASAPLEERTLTGLSVLLQANDLKQA----LRPYCLGGPHGRLLD 595

Query: 580 NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALED 639
            + + L   S  +     + L   +    ++ YLF+R+ D +DGR  +++IDE W AL+D
Sbjct: 596 AEAEHLGQAS--VQAFEIEGLVGAQAAPAVLSYLFHRVSDRLDGRPTLLIIDEGWLALDD 653

Query: 640 DSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NY 696
           + F    ++ LKT+RK+N  ++FATQS  D  NS IA  IIE CPT++  PN +A     
Sbjct: 654 EGFAGQLREWLKTLRKKNASVVFATQSLADIDNSAIAPAIIESCPTRLLLPNARAIEPQI 713

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            D    F L +R+ E++    +   R +  +  + + + EL L  +   +A+ + ++K+ 
Sbjct: 714 ADIYRRFGLNDRQIEILAR--ATPKRDYYCQSRRGNRLFELGLSEVG--LALCAASSKSD 769

Query: 757 E-LVNQIINDYGAD 769
           + L++ II+++G D
Sbjct: 770 QALISAIISEHGRD 783
>nar:Saro_0315 CagE, TrbE, VirB component of type IV transporter system
          Length = 821

 Score =  187 bits (474), Expect = 1e-45
 Identities = 186/785 (23%), Positives = 339/785 (43%), Gaps = 65/785 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V   V+              G + D+A    L +   +LN+ LR +     A
Sbjct: 16  DFLPWAALVAPGVVLNKDGSFQRSARFRGPDLDSATPAELIATTARLNSALRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++   +RR    YPES F  + +A ++ +   +   +   + +  +++L+W P +    +
Sbjct: 75  IFVEAVRRPAHDYPESDFPDAASALVERERAAQFAEEGAHFESAYYLTLVWMPPAEDAAR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY--EARLLSVYAHEGILFSEQ 188
             S+   L + K  Q     E +    + +  L++ +E +  EA  L          SE 
Sbjct: 135 AESW---LYEGKAHQGVQARELLELFSDRTDRLLRLIEGFVPEAAWLDD--------SET 183

Query: 189 SEFLHQLVGGR--RERIPLTFGTIASTIYSDRVIFGKE-MIEIRHESNERFVGMFGWKEY 245
             +LH  +  R  R R+P T   + + +  + +  G E  +   H      VG      +
Sbjct: 184 LTYLHSCISTRNHRVRVPETPMHLDALLADEPLTGGLEPRLGRAHLRTLTVVG------F 237

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MI 290
           PS T PG+ D L +  F +  +   +   K  A  ++G+ + Q               M 
Sbjct: 238 PSATFPGILDELNSQGFAYRWSTRAIMLDKTDAAKLLGKIRRQWFAKRKSVAAILKEVMT 297

Query: 291 NAADR-----ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHL 345
           N A       AS++    D AL +L S+   +     ++ V+ +      E L      +
Sbjct: 298 NEASALLDSDASNKAADADAALQELGSDLQGMAYVTATVTVWDEDAAMAAEKLRLVEKVI 357

Query: 346 TNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLEGNVW 404
                 +  E +    AW   LPG+     R   I++ N A + P  +   G + + +  
Sbjct: 358 QGRDFTVIVEGMNALEAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPEWDAHFR 417

Query: 405 GAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FD 463
              +   +T+  +P+ F  H GD+G+T + GP+G+GK+V++  +  Q ++++   +F FD
Sbjct: 418 APPLFYARTEGSTPFRFALHVGDVGHTLIVGPTGAGKSVLLALMALQFRRYDRAQIFAFD 477

Query: 464 KDQGAEIFVRAGGGKYKPLKN---GQPTGIAPLKGM----EYTEKNKIFLRSWVLKLVTT 516
                     A GG ++ L     G   G   L+ +    E  E+N  +   W+  ++T 
Sbjct: 478 FGGSIRAAALACGGDWQDLGTSLAGDGAGAVMLQPLARIDEPAERN--WAAEWLQAVLTG 535

Query: 517 EGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGW 576
           EG TV    ++ +  A+ SL +   A+R+L  L +   +   + +   L  +  G   G 
Sbjct: 536 EGVTVDPATKEHLWSALTSLSTALVAERTLTGLAVLLQS---QALKQALAPYCIGGPFGR 592

Query: 577 VFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           + D + + L    +F  ++ T+ L        ++ YLF+RI   +DG   +I+IDE W  
Sbjct: 593 LLDAEAEQLGA-GKFQAFE-TEGLTGSAAAPAVLSYLFHRIEGRLDGSPTLIIIDEGWLV 650

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA-- 694
           L+  +F A  ++ LKT+RK+N  ++FATQS  D   S IA  IIE CPT+IF PN++A  
Sbjct: 651 LDSPAFAAQLREWLKTLRKKNASVVFATQSLADIETSAIAPAIIESCPTRIFLPNERAIE 710

Query: 695 -NYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTT 753
                    F L +R+ E+I    +   R +  +  + + + EL L  +    A  S  T
Sbjct: 711 PQILSVYRRFGLNDRQIEIIAR--AAPKRDYYCQSARGNRLFELGLGEVALAFAAASSKT 768

Query: 754 KNIEL 758
             + +
Sbjct: 769 DQLAI 773
>pau:PA14_30910 trbE; TrbE-like protein
          Length = 817

 Score =  186 bits (473), Expect = 1e-45
 Identities = 176/764 (23%), Positives = 318/764 (41%), Gaps = 50/764 (6%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +R +L  +++P+   V   V+              G + D+A    L +   +LN  LR 
Sbjct: 9   QRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRR 68

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMV-SQELYRNDLFVSLLWNP 123
           +     AL+    RR    YP S F    +  +DE+ +     S   + +   ++L++ P
Sbjct: 69  LGSGW-ALFIEAERRAAADYPHSEFPEPLSWLVDEERRATFEESGNHFESGYHLTLVYLP 127

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
                 + A      T          ++A     +   DL++G+    A L         
Sbjct: 128 PEESRARAAKMLYENTPTNGVDWRERLQAFVAETDRVFDLLEGVMPEIAWLDD------- 180

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFVGMFGW 242
             ++   +LH  +  RR R+    G      + D ++    ++  +     +R + +   
Sbjct: 181 --AQTLTYLHATISTRRYRV----GVPEVPFHIDALLTDSPLVGGLAPMLGDRHLRVVSV 234

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR------------------ 284
           + +P+ T PG+ D L    F +  +  F+   K+ A   +GR                  
Sbjct: 235 RGFPTSTWPGILDDLNRLGFGYRWSTRFLCLDKSEAERELGRLRRQWFAKRKNVIALLRE 294

Query: 285 ---KQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
              +Q   +   D  +   DA D AL +L S++   G    ++ V         E L   
Sbjct: 295 TIFQQESPLVDTDANNKAADA-DAALQELGSDQVAFGYLTATVTVMDADASAADEKLRMV 353

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLE 400
              +   G V   E L    AW + LPGN     R   +++ N A + P  +   G +  
Sbjct: 354 ERVIQGRGFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKN 413

Query: 401 GNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
            ++ G  + + +T   +P+    H GD+G+T V GP+G GK+V++  L  Q +++  + +
Sbjct: 414 DHLGGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRI 473

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ 519
           F FD        +   GG++  L         PL  ++  E  + +   W+   +  EG 
Sbjct: 474 FAFDMGCSMRATILGLGGEHYDLGTDGEIAFQPLARID-REGYRTWAAEWIEGRLLHEGV 532

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFD-NTSKEGIAIRLQRWIKGNDLGWVF 578
           TV   E+  I  A+ SL   P  QR++  L +    N  ++ +A     ++ G   G + 
Sbjct: 533 TVGPDEKAAIWSALGSLAGAPVEQRTMTGLSVLLQSNVLRQALA----PYVLGGAHGKLL 588

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE 638
           D D D L + +    ++M + + ++     ++ YLF R  +  DG   ++++DE W  L+
Sbjct: 589 DADHDRLGM-ADVQCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLD 647

Query: 639 DDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---N 695
           D  F A  +  LKT+RK+N  ++FATQS  D  +S+IA  IIE C ++IF PN +A    
Sbjct: 648 DAVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQ 707

Query: 696 YKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNL 739
            +   E F L  R+ E++ +   +    +  + G      +L L
Sbjct: 708 IRTIYEGFGLNRRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGL 751
>rpc:RPC_3898 ATPase
          Length = 813

 Score =  185 bits (470), Expect = 3e-45
 Identities = 183/799 (22%), Positives = 345/799 (43%), Gaps = 71/799 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V Q V+              G + D+A    L  +  +LN  LR +     A
Sbjct: 16  DFLPWAALVGQGVVLNKDGSFQRTATFRGPDLDSAVPAELVGITARLNNALRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R   + YPE  F  + +A +D + + +   +   + +  F++ L+ P +    +
Sbjct: 75  VFVEAQRHPASKYPECHFPDAASALVDLERRAQFEEEGAHFESSYFLTFLYLPPAADVAR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSV---YAHEGILFSE 187
                +RL    + + E            +++++ G      R+L +   +  E     +
Sbjct: 135 A----ERLLYEGRDRDEGTD---------AREILGGFVDRTDRVLQLVEGFMPESAWLDD 181

Query: 188 QSE--FLHQLVGGRRERIPLTFGTI-ASTIYSDRVIFG--KEMIEIRHESNERFVGMFGW 242
           Q    +LH  +  +R RI +    +    + +D+ + G  + M+   H      VG    
Sbjct: 182 QDTLTYLHSTISTKRYRIRVPETPMYLDALLADQPLTGGLEPMLGNAHLRVLTIVG---- 237

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ-------------- 288
             +P+ T PG+ D L    F +  +   +   K  A  ++ + + Q              
Sbjct: 238 --FPTTTTPGILDELNALAFAYRWSTRAIMLDKTDATKLLTKIRRQWFAKRKSIAAILKE 295

Query: 289 -MINAA------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
            M N A      D  +  +DA D AL +L S+         ++AV+   P+   E L   
Sbjct: 296 VMTNEAATLVDTDAQNKAMDA-DAALQELGSDAIGQAFVTATVAVWDGDPRAADEKLRLV 354

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEG 401
              +         E +    AW   LPG+     R   +++ N A + P  +   G L  
Sbjct: 355 EKVIQGRDFTCMAESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPLRD 414

Query: 402 NVWGAA-VALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
           + + A  +   +T+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++  + V
Sbjct: 415 DHFDAPPLFFARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQV 474

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNG------QPTGIAPLKGMEYTEKNKIFLRSWVLKL 513
           F FD          A GG +  L         +P  + PL  ++   +   +   W+  +
Sbjct: 475 FAFDFGGSIRAAALAMGGDWHDLGGALSDNATEPVALQPLALIDDAAERG-WAAEWIGNI 533

Query: 514 VTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGND 573
           +  E   +T + ++ +  A++SL S P  +R+L  L +   + +   +   LQ +  G  
Sbjct: 534 LARETIRITPEAKEHLWSALSSLASAPAPERTLTGLSVLLQSQT---LKRALQSYCLGGP 590

Query: 574 LGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEF 633
            G + D + + L   +  +    T+ L        ++ YLF+RI   +DGR  +++IDE 
Sbjct: 591 YGRLLDAEAERLGEGA--VQAFETEGLIGTSAAPAVLGYLFHRIERRLDGRPTLLIIDEG 648

Query: 634 WKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQK 693
           W AL+D+ F    ++ LKT+RK+N  ++FATQS  D   S IA  IIE CPT++F PN++
Sbjct: 649 WLALDDEGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPTRLFLPNER 708

Query: 694 A---NYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILS 750
           A           F L +R+ E++    +   R +  +  + + + EL L G+   +A  S
Sbjct: 709 AIEPQITAIYRRFGLNDRQIEILAR--ATPKRDYYCQSRRGNRLFELGLGGVALALAAAS 766

Query: 751 GTTKNIELVNQIINDYGAD 769
               +  L+  +I ++G D
Sbjct: 767 SKADH-TLIESVIAEHGRD 784
>rpe:RPE_4021 AAA ATPase
          Length = 813

 Score =  184 bits (467), Expect = 7e-45
 Identities = 181/795 (22%), Positives = 352/795 (44%), Gaps = 63/795 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V Q V+           +  G + D+A    L  +  +LN  LR +     A
Sbjct: 16  DFLPWAALVGQGVVLNKDGSFQRTASFRGPDLDSAVPAELVGVAARLNNALRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R   + YPE  F  + +A +D + + +   +   + +  F++ L+ P +     
Sbjct: 75  VFVEAQRHPASKYPECHFPEAASALVDLERRAQFEEEGAHFESSYFLTFLYLPPAA---D 131

Query: 131 LASFFQRLTKAKKTQSEPDM-EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQS 189
           +A   + L + ++     D  E +R   + +  ++Q +E +      +   + + +    
Sbjct: 132 VARAERLLYEGRERDEGTDAREILRGFVDRTDRVLQLVEGFMPESAWLDGQDTLTY---- 187

Query: 190 EFLHQLVGGRRE--RIPLTFGTIASTIYSDRVIFGKE-MIEIRHESNERFVGMFGWKEYP 246
             LH  +  +R   R+P T   + + +    +  G E M+   H      VG      +P
Sbjct: 188 --LHSTISTKRYGIRVPETPMYLDALLADQPLTGGLEPMLGNAHLRVLTIVG------FP 239

Query: 247 SKTRPGMTDGLLTAPFEF----------------ILTQ---SFVFKSKAAARVIMGRKQN 287
           + T PG+ D L    F +                +LT+    +  K K+ A ++     N
Sbjct: 240 TATTPGILDELNALAFAYRWSTRAIMLDKTDATRLLTKIRRQWFAKRKSIAAILKEVMSN 299

Query: 288 QMINAADR-ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLT 346
           +     D  A ++    D AL +L S+         ++AV+ + P+   E L      + 
Sbjct: 300 EAATLVDTDAQNKAMDADAALQELGSDAIGQAFVTATVAVWDNDPRGADEKLRLVEKVIQ 359

Query: 347 NGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVW-G 405
                   E +    AW   LPG+     R   +++ N A + P  +   G L    + G
Sbjct: 360 GRDFTCMVESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPLRDEHFDG 419

Query: 406 AAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDK 464
             +   +T+  +P+ F+ H GD+G+T V GP+G+GK+V++  +  Q +++  + VF FD 
Sbjct: 420 PPLFFARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFTFDF 479

Query: 465 DQGAEIFVRAGGGKYKPLKNG------QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
                    A GG +  L         +P  + PL  ++   +   +   W+  ++  E 
Sbjct: 480 GGSFRAPALAMGGDWHDLGGALSDNATEPVALQPLALIDDAAERG-WAAEWIGNILARET 538

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVF 578
             +T + ++ +  A++SL S P ++R+L  L +   + +   +   LQ +  G   G + 
Sbjct: 539 IRITPEAKEHLWSALSSLASAPVSERTLTGLSVLLQSQT---LKRALQSYCLGGPYGRLL 595

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE 638
           D + + L   +  +    T+ L        ++ YLF+RI   +DGR  +++IDE W AL+
Sbjct: 596 DAEAERLGEGA--VQAFETEGLIGTSAAPAVLGYLFHRIERRLDGRPTLLIIDEGWLALD 653

Query: 639 DDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---N 695
           D+ F    ++ LKT+RK+N  ++FATQS  D   S IA  IIE CPT++F PN++A    
Sbjct: 654 DEGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPTRLFLPNERAIEPQ 713

Query: 696 YKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTK- 754
                  F L +R+ E++    +   R +  +  + + + EL L G+   +A+ + ++K 
Sbjct: 714 ITAIYRRFGLNDRQIEILAR--ATPKRDYYCQSRRGNRLFELGLGGV--ALALTAASSKA 769

Query: 755 NIELVNQIINDYGAD 769
           +   + +I++++G D
Sbjct: 770 DQAAIEKILSEHGCD 784
>mlo:mlr6400 conjugal transfer protein trbE; K03199 type IV secretion system
           protein VirB4
          Length = 816

 Score =  181 bits (459), Expect = 6e-44
 Identities = 182/800 (22%), Positives = 336/800 (42%), Gaps = 72/800 (9%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V   ++      +   +   G + +++    L  +  + N  LR +      
Sbjct: 16  DHLPWAALVAPGIVLNKDGSVQRTLRFRGPDLESSTEAELLGICARANNALRRLGSGWTL 75

Query: 72  LYSHIIRRRETI-YPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTE 129
            +     R E + YP SRF  + +  +DE+ +     +   + +   ++LL  P      
Sbjct: 76  FFE--AERIEALGYPSSRFPDAASWLVDEERRAAFEGKVAHFESRCHLTLLSMPPPDAQA 133

Query: 130 QLASFFQRLTKAKKTQSEPD----MEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILF 185
           +  S    L  +  ++ E D    M   R   +   DL+ G    E R L          
Sbjct: 134 RAES---ALVDSHHSEGERDWRQEMARFRDETDRVLDLLSGFMP-EVRPLDD-------- 181

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMI----EIRHESNERFVGMFG 241
           +E   +LH  +  RR  + +      + +Y D ++    +      +  E + R + + G
Sbjct: 182 AETLTYLHDTISTRRHPVAVP----ETPMYLDGILVDVPLTGGLEPMLGEQHLRTLTILG 237

Query: 242 WKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINA--------- 292
              +P+ TRPG+ D L    F +     F+   K  A   + R + Q             
Sbjct: 238 ---FPNLTRPGILDALNHQDFAYRWMTRFIPLDKTEATKTLTRLRRQWFAKRKSIVAILR 294

Query: 293 ------------ADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSK 340
                       +D  +  +DA DEAL  L  +    G    ++ V+ +  +   E L  
Sbjct: 295 EVVSNEPVPLVDSDADNKALDA-DEALQALGGDHVGFGYLTATVTVWDEDRQAAAEKLRA 353

Query: 341 ARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLE 400
               +   G    RE +    AW   LPG+     R   + + N A L P  S   G   
Sbjct: 354 VERIINGLGFTTIRESVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPAA 413

Query: 401 GN----VWGAA---VALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQ 453
                 V G     + + +T   +P+  + H  D+G+  + GP+G+GK+V++  +  Q +
Sbjct: 414 NEHLAEVTGREAPPLLIAETSGSTPFRLSSHVEDVGHMLIVGPTGAGKSVLLALIALQFR 473

Query: 454 KHNPTMVF-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLK 512
           ++    V+ FDK   A     A GG++  L +       PL+ +   +  + +   W+  
Sbjct: 474 RYAGAQVYVFDKGNSARAATLAMGGEHHVLGSDGALAFQPLRNIG-DQGRRSWAAEWIAG 532

Query: 513 LVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGN 572
           L+  E  T+T + ++ I  A+NSL + P  +R+L  L +   + + +     L  +    
Sbjct: 533 LIAHENVTLTPEVKEAIWSALNSLATAPAQERTLTGLSVLLQSNALKSA---LMPYTLDG 589

Query: 573 DLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDE 632
             G + D D D L L S    ++  + + ++    P++ YLF+R+ +  DGR  ++++DE
Sbjct: 590 PFGRLLDADDDRLAL-SDVQCFETEELMHSQSAVLPVLTYLFHRLEERFDGRPTLLMLDE 648

Query: 633 FWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQ 692
            W  L++  F A  ++ LK +RK+N  ++FATQS  D   S IA  IIE CP +IF PN 
Sbjct: 649 AWVYLDNPLFAARIREWLKVLRKKNVSVIFATQSLADIAGSAIAPAIIESCPQRIFLPND 708

Query: 693 KA---NYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           +A     +   E F L +R+ ELI    +   R + ++    + + EL L  +   +   
Sbjct: 709 RAVEPQARTAYERFGLNDRQIELIAR--ATPKRHYYLQSRCGNRLFELGLGPIALALCGA 766

Query: 750 SGTTKNIELVNQIINDYGAD 769
           SG      L++++++ +G D
Sbjct: 767 SGPAAQ-SLIDRVLSKHGQD 785
>sal:Sala_2611 hypothetical protein
          Length = 829

 Score =  180 bits (457), Expect = 1e-43
 Identities = 172/737 (23%), Positives = 324/737 (43%), Gaps = 56/737 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P++  V   V+              G + D+A    L S+  +LN  LR +     A
Sbjct: 16  DFLPWVALVAPGVVLNKDGSFQRTARFRGPDLDSATPAELVSVTARLNNALRRLG-SGWA 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLD-EKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YP S F    +A +D E+ ++   +   + +  +++LLW P +   E+
Sbjct: 75  VFVEAQRVPALDYPNSAFPDPVSALVDMERGEQFREAGSHFESGYYLTLLWMPPA---EE 131

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
            A     L + +        E +    + +  ++  +E +   +        +  +E   
Sbjct: 132 AARAENWLYEGRSGGGVDPHEQLAGFIDRTNRVLHLVEGFMPEV------GWLDDAETLT 185

Query: 191 FLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMI-EIRHESNERFVGMFGWKEYPSKT 249
           +LH  V  RR+R+ +      +  Y D ++  + +   +  +  E  + +     +P+ T
Sbjct: 186 YLHSCVSTRRQRVRVP----ETPCYLDALLTDEGLTGGLEPKLGEHHLRVATATGFPTAT 241

Query: 250 RPGMTDGLLTAPFEF----------------ILT---QSFVFKSKAAARVIMGRKQNQ-- 288
            P + D L    F +                +LT   + +  K K+ A ++     N+  
Sbjct: 242 FPSLLDELNRLAFPYRWSTRAIMLDKTDATKLLTKIRRQWFAKRKSVAAILKEVMTNEAS 301

Query: 289 MINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNG 348
           ++  +D ++   DA D AL +L ++   +     ++ V+   P    E L      +   
Sbjct: 302 VLTDSDASNKAADA-DLALQELGADHSGIAYVTATVTVWDRDPALAAEKLRLVEKIIQGR 360

Query: 349 GAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAV 408
                 E +    AW   LPG+     R   I++ N A L P  +   G      +G A 
Sbjct: 361 DFTATIEGMNAIEAWLGSLPGHVYANVRQPPISTLNLAHLIPLSAVWAGAERDEHFGDAP 420

Query: 409 ALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKDQ 466
            L  KT+  +P+  + H GD+G+T + GP+G+GK+V++  +  Q +++    +F FD   
Sbjct: 421 LLYGKTEGSTPFRLSLHVGDVGHTLIVGPTGAGKSVLLALMAMQFRRYADNQIFAFDFGG 480

Query: 467 GAEIFVRAGGGKYKPL-------KNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ 519
                  A GG ++ L         G+   + PL  ++     + +   W+  ++++EG 
Sbjct: 481 SIRAAAIACGGDWQDLGGALHDRDGGEGVTLQPLARID-DPGERAWAAEWLAAILSSEGV 539

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFD 579
           TV    ++ +  A+ SL S P  +R+L  L +   +   + +   L  +  G   G + D
Sbjct: 540 TVDPAAKEHLWTALGSLASAPPPERTLTGLAVLLQS---QELKQALAPYCVGGPWGRLLD 596

Query: 580 NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALED 639
            + + L  ++ F  ++ T+ L        ++ YLF+RI   +DGR  +I+IDE W  L+ 
Sbjct: 597 AEAEHLG-EASFQAFE-TEGLVGAASAAAVLAYLFHRIEGRLDGRPTLIIIDEGWLVLDS 654

Query: 640 DSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NY 696
            +F A  ++ LKT+RK+N  ++FATQS  D   S+IA  IIE CPT+IF PN++A     
Sbjct: 655 PAFAAQLREWLKTLRKKNSSVIFATQSLADIETSSIAPAIIESCPTRIFLPNERAAEPQI 714

Query: 697 KDYVEDFKLTEREFELI 713
               E F L +R+ E++
Sbjct: 715 ARVYERFGLNDRQIEIL 731
>rso:RSc2581 trbE, RS00789; probable conjugal transfer protein TrbE; K03199 type
           IV secretion system protein VirB4
          Length = 816

 Score =  180 bits (457), Expect = 1e-43
 Identities = 180/755 (23%), Positives = 315/755 (41%), Gaps = 52/755 (6%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +R +L  +++P+   +   V+              G + D+A    L +   +LN  LR 
Sbjct: 9   QRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATTARLNNALRR 68

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMV-SQELYRNDLFVSLLWNP 123
           +     AL+    RR    YP S F    +  +DE+ +     S   + +   ++L + P
Sbjct: 69  LGSGW-ALFIEAERRPAADYPYSDFPEPLSWLVDEERRAAFEESGNHFESTYHLTLAYLP 127

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
                 + A                 ++A     +   DL+ G+    A L         
Sbjct: 128 PEESRARAAKLLYEHAPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDD------- 180

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTI-ASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             +    +LH  +  RR R+ +         + +D  + G  +  +  + + R V + G 
Sbjct: 181 --AATLTYLHATISTRRYRVGVPEVPFHLDALLADSALVGG-LAPMLGDQHLRVVSVRG- 236

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR------------------ 284
             +P+ T PG+ D L    F +  +  F+   KA A   +GR                  
Sbjct: 237 --FPTSTWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQWFAKRKNVIALLRE 294

Query: 285 ---KQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
              +Q   +   D ++   DA D AL +L S++   G    ++ V    P    E L   
Sbjct: 295 TIFQQESPLVDTDASNKAADA-DAALQELGSDQVAFGYLTATVTVLDADPAVADEKLRMV 353

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLE 400
              +   G V   E L    AW + +PGN     R   +++ N A + P  +   G +  
Sbjct: 354 ERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPERN 413

Query: 401 GNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
            ++ G  V + +T   +P+    H GD+G+  V GP+G GK+  +  L  Q +++  + +
Sbjct: 414 KHLDGPPVIVTRTDGATPFRLVTHIGDVGHMAVVGPTGMGKSAFLAVLAMQFRRYLHSRI 473

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIA--PLKGMEYTEKNKIFLRSWVLKLVTTE 517
           F FD  +     +   GG++  L  G   GIA  PL  ++  E  + +   WV   +  E
Sbjct: 474 FVFDMGRSMRATILGLGGEHYDL--GADGGIAFQPLAHID-AEGYRTWAAEWVEGRLLHE 530

Query: 518 GQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWV 577
           G TV   E+  I  A+ SL   P  QR++  L +   + +   +   L  ++ G   G +
Sbjct: 531 GVTVGPDEKAGIWSALGSLAGAPVEQRTMTGLSVLLQSNA---LRQALAPYVLGGAHGKL 587

Query: 578 FDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKAL 637
            D D+D L   +    ++M + + +    R ++ YLF R  +  DG   ++++DE W  L
Sbjct: 588 LDADRDRLG-SADVQCFEMEELMASPAAVRSVLGYLFARFDERFDGSPTLLILDESWLFL 646

Query: 638 EDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA--- 694
           +D  F A  +  LKT+RK+N  ++FATQS  D  NS+IA  IIE C  +IF PN +A   
Sbjct: 647 DDPVFAARIRQWLKTLRKRNVSVVFATQSLADIQNSSIAAAIIESCAVRIFLPNPQATEP 706

Query: 695 NYKDYVEDFKLTEREFELIQSELSRESRRFLIKQG 729
             +   E F L  R+ E++ +   ++   +  + G
Sbjct: 707 QIRTIYEGFGLNSRQIEIVATAQPKQDYYYQSRLG 741
>bja:bll8285 trbE; probable conjugal transfer protein; K03199 type IV secretion
           system protein VirB4
          Length = 812

 Score =  178 bits (452), Expect = 4e-43
 Identities = 180/800 (22%), Positives = 340/800 (42%), Gaps = 62/800 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P+   V + V+              G + D+A    L  +  +LN  LR +     A
Sbjct: 16  DFLPWAALVEKGVVLNKDGAFQRTARFRGPDLDSATPAELVGVTARLNNALRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLD-EKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YP + F  + +A +D E+      +   + +  F++ +W P +    +
Sbjct: 75  IFVEAQRIAAQTYPHNTFPDAASALVDLERRDAFEEAGAHFESRYFLTFVWLPPAEDASR 134

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
           +  +   L + +        E +R   + +  ++Q +E +   +   +  +G    E   
Sbjct: 135 IEGW---LYEGRAQSGVDPHELLRGFVDRTNRVLQLVEGFMPEV--AWLDDG----ETLT 185

Query: 191 FLHQLVGGRRERI--PLTFGTIASTIYSDRVIFGKE-MIEIRHESNERFVGMFGWKEYPS 247
           +LH  +  R++R+  P T   + + +  + +  G E  +   H      VG      +P+
Sbjct: 186 YLHSTISTRQQRVRVPETPMHLDALLADEPLAGGLEPRLGNHHLRTLTVVG------FPT 239

Query: 248 KTRPGMTDGL--LTAPFEFILTQSFVFKSKAAARVIMGRKQ-------------NQMINA 292
            T PG+ D L  L  P+ +      + K++A   +   R+Q               M N 
Sbjct: 240 ATYPGILDELNRLAFPYRWSTRAILLDKTEAVKLLTKIRRQWFAKRKSIAAIVKEVMTNE 299

Query: 293 A------DRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLT 346
           A      D A+   DA D AL +L ++         ++ V+ + P    E L      + 
Sbjct: 300 ASTLVDSDAANKATDA-DLALQELGTDDVGQAYITATVTVWDEDPGLATEKLRLVEKVIQ 358

Query: 347 NGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA 406
                   E +    AW   LPG+     R   +++ N A L P  +   G      + +
Sbjct: 359 GRDFTCMPEGVNALEAWLGSLPGHAYANVRQPPLSTLNLAHLIPLSAVWAGSDRDEHFRS 418

Query: 407 AVALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDK 464
           +     KT+  +P+ F+ H GD+G+T + GP+G+GK+V++  +  Q +++  + +F FD 
Sbjct: 419 SPLFFGKTEGSTPFRFSLHVGDVGHTLIVGPTGAGKSVLLALMAIQFRRYRKSQIFAFDF 478

Query: 465 DQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEK-----NKIFLRSWVLKLVTTEGQ 519
                    A GG +  L             ++   +      + +   WV  ++  EG 
Sbjct: 479 GGSIRTAALAMGGDWHDLGGSLSNSAEDSVSLQPLARIGDAAERAWAAEWVTAILAKEGV 538

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFD 579
           T+    ++ +  A+ SL S P  +R++  L +   +T+   +   LQ +  G   G + D
Sbjct: 539 TIDPTVKEHVWSALTSLASSPAEERTITGLTVLLQSTA---LKQALQPYCVGGSSGRLLD 595

Query: 580 NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALED 639
            + + L   S  +    T+ L        ++ YLF+RI   +DGR  +++IDE W  L+D
Sbjct: 596 AEAEQLGFAS--VQAFETEGLIGAGAAPAVLTYLFHRIEGRLDGRPTLLIIDEGWLVLDD 653

Query: 640 DSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NY 696
            +F    ++ LKT+RK+N  ++FATQS  D   S IA  I+E CPT+IF PN++A     
Sbjct: 654 PAFAQQLREWLKTLRKKNASVVFATQSLSDIDGSNIAPAIVESCPTRIFLPNERAIEPQI 713

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
               + F L +R+ E+I    +   R +  +  + + + EL L  +       S  T + 
Sbjct: 714 TAIYQRFGLNDRQIEIIAR--ATPKRDYYCQSRRGNRLFELGLGPVALAFCAASSKTDH- 770

Query: 757 ELVNQIINDYGADPDT--WL 774
             + +++ ++G D  T  WL
Sbjct: 771 AAIERLLAEHGRDDFTAAWL 790
>pol:Bpro_5229 type IV secretory pathway VirB4 components-like; K03199 type IV
           secretion system protein VirB4
          Length = 846

 Score =  178 bits (452), Expect = 4e-43
 Identities = 190/784 (24%), Positives = 323/784 (41%), Gaps = 83/784 (10%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           E +P+   V   ++      L+     EG + +       +   NQL T LR + D R+ 
Sbjct: 20  ELLPWFAQVAPGLVICQDGSLLAGYTFEGSDVEGRQDFESDQKINQLQTALRTLTD-RIT 78

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWN-PTSGKTEQ 130
           +++   RR  + YP+  F S  A  +DE+++K +  Q   R    + L +N P S +   
Sbjct: 79  MWTVQERRFVSGYPKGDFSSPIARAIDEQWEKSISKQRNARLTQRIYLGFNFPNSSE--- 135

Query: 131 LASFFQRLTKAKKTQSE---------------PDMEAIRKIEELSQDLIQGLESYEARLL 175
             +FF+ L +A+  +++                D  AI K+     D+    E       
Sbjct: 136 --AFFEAL-RAELEENDGKVLAALGGLIKRRLSDKGAIAKVRGQLADMTTEFEKLLGAFS 192

Query: 176 SVY-AHEGILFSEQSEFLHQLVGGRR-------ERIPLTFGTIASTIYSDRVIFGKEMIE 227
            +   + G    E  EFL  L             R+P     + + + SD +I  ++  E
Sbjct: 193 GIVETNLGFKRLEGEEFLGDLYSRANLASPPGPVRLPKGGAYLNTALASDTLIRRQDQFE 252

Query: 228 IRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAA--------- 278
            +  +   +V        P +   G  D L+    E++L Q + F  +  A         
Sbjct: 253 FKGPTKSAYVAALSTTGTPQEAYSGYMDSLMAVDCEYVLVQCYRFIDRTVAEKAIQDAEM 312

Query: 279 -----------RVI--MGRKQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLA 325
                      RV   M   +++ +N  +   +Q DA D AL +L ++    G +++++ 
Sbjct: 313 FYRSEVKSVLTRVFERMTDSESEKVNTGNLQLAQ-DAQD-ALVELTASDVSYGYYNMTIL 370

Query: 326 VFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNF 385
                 K          ++L   G  I RE  GL +A+ A +PGN     R    ++ N 
Sbjct: 371 ALGTTQKEAENAADLMASNLRANGFTILRERQGLMSAFLATMPGNADAILRWKLASTANL 430

Query: 386 AALSPFHSFPIGKLEGNVWGA-------AVALLKTQAGSPYYFNFHYGDLGNTFVCGPSG 438
           A L+P  +   G+    ++         A+A   T  G  Y FN H  D+G+T V G +G
Sbjct: 431 ADLAPIRTISKGEPTHPLFSRLIGHDVPALARFLTPYGVTYDFNNHETDVGHTAVIGGTG 490

Query: 439 SGKTVIVNFLLAQLQKHNPTMVF-FDKDQGAEIFVRAGGGKYKPL--KNGQPTGIAPLKG 495
           +GKT ++  L++  QK+NP   F FD      +     GGK+  +  K G+  G+ P+K 
Sbjct: 491 AGKTSLMTLLISMFQKYNPGQTFIFDMKYSLMMATVLLGGKHIDMGGKGGKTIGMNPVKT 550

Query: 496 MEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDN 555
           M     + + LR WV  L+   G T++  E Q I  AI  L   P +   L AL      
Sbjct: 551 M-LLANDDMQLRQWVEVLIGAGGNTISSNESQVIYTAIQGLRRSPPSTWRLSALYALIAG 609

Query: 556 TSKEGIAIRLQRWIKGND--------LGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRR 607
             ++ +A +L  ++   D            FDND+D   L +Q +G ++   L   ++  
Sbjct: 610 ADQD-LAAKLSPYVDRTDDDEIGSGPYASYFDNDEDHFQL-TQIVGMEVEGILKTPQLAS 667

Query: 608 PLMMYLFNRILDLIDGRR-IIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQS 666
           P M Y F  I   +DG    +I I+E W  L + +F    +  L+T R +   ++FATQS
Sbjct: 668 PFMDYAFYNIERRLDGATPTLIYIEEAWYMLANKAFVEKFETWLRTFRSKRAFIVFATQS 727

Query: 667 PKDALNSTIAHTIIEQCPTQIFFPNQKANYKD----YVEDFKLTEREFELIQSELSRESR 722
             +         I+   PTQI  P  K +       Y + F + + + +L+   + +  R
Sbjct: 728 LGEIARLENLEGIVTNIPTQILLPAVKNSVHQQADLYKDVFGINDNQLDLLSRAIPK--R 785

Query: 723 RFLI 726
            +LI
Sbjct: 786 DYLI 789
>sal:Sala_2483 putative conjugal transfer protein
          Length = 814

 Score =  177 bits (449), Expect = 9e-43
 Identities = 176/794 (22%), Positives = 342/794 (43%), Gaps = 61/794 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           +++P++  V + V+              G + D+A    L ++ ++LN  LR +     A
Sbjct: 16  DFLPWVCLVAEGVVLNKDGSFQRTARFRGPDLDSATPAELVAVTSRLNNTLRRLGSGW-A 74

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQEL-YRNDLFVSLLWNPTSGKTEQ 130
           ++    R     YP S F    +  +D + +++   +   + +  +++LLW P +   E+
Sbjct: 75  VFVEAQRVPAMTYPVSEFPDPVSELVDIERREQFREEGAHFESFYYLTLLWMPPA---EE 131

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSE 190
            A     L + +        E ++   + ++ ++  +E +   +      E +   E   
Sbjct: 132 AARAEAWLYEGRSKTGVDAQELLKSFADRTERVLHLVEGFMPEV------EWLGDGETLT 185

Query: 191 FLHQLVG--GRRERIPLTFGTIASTIYSDRVIFGKE-MIEIRHESNERFVGMFGWKEYPS 247
           +LH  +    +R R+P T   + + +  + ++ G E  +   H       G      +PS
Sbjct: 186 YLHSCISTKAQRVRVPETPAYLDALLADEALVGGLEPRLGDHHLRTLTITG------FPS 239

Query: 248 KTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQ---------------MINA 292
            T PG+ D L    F +  +   +   K  A  ++ + + Q               M N 
Sbjct: 240 VTFPGLLDELNRQAFGYRWSSRAIMLDKTDATKLLTKIRRQWFAKRKSVAAILKEVMTNE 299

Query: 293 AD-----RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTN 347
           A       AS++    D AL +L ++   +     ++ V+   P    E L      + +
Sbjct: 300 ASVLMDSDASNKAADADMALQELGADEAGIAYVTATITVWDRDPALAAEKLRLVEKIVQS 359

Query: 348 GGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAA 407
                  E +    AW+  LPG+     R   +++ N A L P  +   G      +G +
Sbjct: 360 RDFTCTVEGVNALEAWFGSLPGHVYANVRQPPVSTLNLAHLIPLSAVWAGAERDEHFGQS 419

Query: 408 VALL-KTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKD 465
             L  KT+  +P+  + H GD+G+  V GP+G+GK+V++  +  Q +++  + +F FD  
Sbjct: 420 PLLYGKTEGSTPFRLSLHVGDVGHCLVVGPTGAGKSVLLALMAMQFRRYEGSQIFAFDYG 479

Query: 466 QGAEIFVRAGGGKYKPLKN-----GQPTGIA--PLKGMEYTEKNKIFLRSWVLKLVTTEG 518
                     GG ++ L       G    +A  PL  ++   + + +   W+  L+T EG
Sbjct: 480 GSIRAAALGMGGDWQDLGGALHDAGSDGSVALQPLARIDEPAE-RAWAAEWLAALLTGEG 538

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVF 578
             V    ++ +  A+ SL + P  +R+L  L +   +   + + + L  ++ G   G + 
Sbjct: 539 VAVDPAAKEHLWSALTSLATAPVTERTLTGLAVLLQS---QELKLALSPYLVGGPWGRLL 595

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE 638
           D + +  +L S  +    T+ L        ++ YLF+RI   +DG   +I+IDE W  L+
Sbjct: 596 DAEVE--HLGSARVQALETEGLVGASSAATVLSYLFHRIERRLDGSPTLIIIDEGWLVLD 653

Query: 639 DDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---N 695
             +F A  ++ LKT+RK+N  ++FATQS  D   S+IA  IIE CPT+IF PN++A    
Sbjct: 654 SPAFAAQLREWLKTLRKKNASVIFATQSLADIEGSSIAPAIIESCPTRIFLPNERAAEPQ 713

Query: 696 YKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKN 755
                + F L  R+ E++    +   R +  +  + + + +L L  +    A  S  +  
Sbjct: 714 IARVYDRFGLNSRQVEILSR--ATPKRDYYCQSRRGNRLFDLGLGDIALAFAAASSKSDQ 771

Query: 756 IELVNQIINDYGAD 769
           I  + +++  +G D
Sbjct: 772 IR-IGELMAAHGQD 784
>rme:Rmet_1553 ATPase
          Length = 809

 Score =  177 bits (449), Expect = 9e-43
 Identities = 169/737 (22%), Positives = 308/737 (41%), Gaps = 48/737 (6%)

Query: 5   KRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRN 64
           +R +L  +++P+   V   ++              G + D+A    L +   +LN  LR 
Sbjct: 9   QRPALLADWLPWAGLVAPGIVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRR 68

Query: 65  IADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMV-SQELYRNDLFVSLLWNP 123
           +     AL+    RR    YP S F    +  ++E+ +     S   + +   ++LL+ P
Sbjct: 69  LGSGW-ALFIEAERRAAADYPRSEFPEPLSWVVEEERRAAFEDSGNHFESGYHLTLLYLP 127

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
                 + A      T          ++A     +   DL+ G+         +   + +
Sbjct: 128 PEESRARAAKMLYENTPTNGVDWRERLQAFVAETDRVFDLLDGV---------MPEVDWL 178

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTI-ASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             ++   +LH  +  RR  + +         + +D  + G  +  +  + + R V + G 
Sbjct: 179 DDAQTLTYLHATISTRRYSLAVPEVPFHIDALLTDSPLVGG-LAPMLGDQHLRVVSVRG- 236

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR------------------ 284
             +P+ T PG+ D L    F +  +  F+   KA A   + R                  
Sbjct: 237 --FPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELSRLRRQWFAKRKNVIALLRE 294

Query: 285 ---KQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
              +Q   +   D  +   DA D AL +L S++   G    ++ V         E L   
Sbjct: 295 TIFQQESPLVDTDANNKAADA-DAALQELGSDQVAFGYLTATVTVMDTDAAVADEKLRMV 353

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG-KLE 400
              +   G V   E L    AW + +PGN     R   +++ N A L P  +   G +  
Sbjct: 354 ERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHLMPVSAVWAGPERN 413

Query: 401 GNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMV 460
            ++ G  + + +T   +P+    H GD+G+T V GP+G GK+V++  L  Q +++  + +
Sbjct: 414 DHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYPGSRI 473

Query: 461 F-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ 519
           F FD  +     +   GG++  L         PL  ++  E  + +   W+   +  EG 
Sbjct: 474 FAFDMGRSMRATILGLGGEHYDLGTDGEIAFQPLARID-REGYRTWAAEWIEGRLLHEGV 532

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFD 579
            V  +E+  I  A+ SL   P  QR++  L +   + +   +   L  ++ G   G + D
Sbjct: 533 AVGPEEKAAIWSALGSLAGAPVEQRTMTGLSVLLQSNA---LRQALSPYVLGGAHGKLLD 589

Query: 580 NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALED 639
            D D L + +    ++M + + ++     ++ YLF R  +  DG   ++++DE W  L+D
Sbjct: 590 ADHDRLGM-ADVQCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLDD 648

Query: 640 DSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKA---NY 696
             F A  +  LKT+RK+N  ++FATQS  D  +S+IA  IIE C ++IF PN +A     
Sbjct: 649 PVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQI 708

Query: 697 KDYVEDFKLTEREFELI 713
               E F L  R+ E++
Sbjct: 709 HTIYEGFGLNRRQIEIV 725
>psp:PSPPH_B0028 conjugal transfer protein; K03199 type IV secretion system protein
           VirB4
          Length = 850

 Score =  177 bits (448), Expect = 1e-42
 Identities = 186/807 (23%), Positives = 345/807 (42%), Gaps = 68/807 (8%)

Query: 10  PEEYIPYIRH-VNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE 68
           PE+ +P +R+ V++H++ L    L++++ ++GV+ +T   + L  L N LN     +  +
Sbjct: 12  PEKKVPLMRYPVHEHMVTLPGNRLVSLIQLKGVSSETRSDDELIQLFNNLNRYFLALGKK 71

Query: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKT 128
                 H++ +         + +     LD +Y   + + +      FV     P    T
Sbjct: 72  EG---KHLMLQT--------YITKTGIELDTQYTLPLPALQD-----FVDAYTAPFRNGT 115

Query: 129 EQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE-GILFSE 187
                +   L   K  + +  +E +  +  LS  L   L  Y+  ++ +  +E   LFS+
Sbjct: 116 FYQVGYSIALI-LKYREVDEGIERMSDLLSLSSTL---LAEYDPVIMGLEENEHDALFSQ 171

Query: 188 QSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK-EMIEIR-HESNERFVGMFGWKEY 245
              +   L+ G  + + ++   +   I      F   + +E R +   +RF   F  ++Y
Sbjct: 172 IGRYYSLLINGHEKDVLVSDTRLGDAIIDSVTNFENYDFVENRPNRGGQRFATTFDLRDY 231

Query: 246 PSK-TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALD 304
           PS  T PGM D  +   FEF L Q+F+F+ +  A+    +K    + + +R S Q + L+
Sbjct: 232 PSGGTYPGMWDEAIEQQFEFTLVQTFLFEDRNKAKDKF-KKHVADLGSVERDSRQTEELE 290

Query: 305 EALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWW 364
            A+D +       G +H SL V+   P   +E  +K  +  T   A   R  +     W+
Sbjct: 291 NAIDAITLGDKAFGRYHASLIVYGKTPDQAIENGTKMASVFTVRDATFVRSTMSNIDTWY 350

Query: 365 AQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLK--TQAGSPYYFN 422
            Q PG  +        ++ N A     HS P GK+ GN  G    L+   T   + Y  N
Sbjct: 351 TQFPG-VTEALYPMMKSTENLACSFSLHSTPTGKVRGNPIGDGTGLMPVLTVNKALYVLN 409

Query: 423 FH--------YGDL--GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFV 472
            H         G++  G+    G +G GKT     LL  L + +P +   D ++     +
Sbjct: 410 VHDSPPGQNNLGEMLPGHAVYTGQTGVGKTTAEATLLTFLSRFDPLIFGIDYNESLRHLL 469

Query: 473 RAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKA 532
            A G +Y  ++ G  TG+ P +  +        LR  ++ LV        + +  D    
Sbjct: 470 CALGAEYYTVQPGHFTGVNPFQFHDSPG-----LRQMLIDLVLCCAGGPDKSDEADQRTI 524

Query: 533 INSLES-LPHAQRSLGALQLFFDNTSKEG---IAIRLQRWIK------GNDLGWVFDNDQ 582
            +S+E+ + H    L  + L   N    G   +  RL +W +           WV D+  
Sbjct: 525 KDSVEAVMAHTNVRLRGMSLLLQNIPLRGGNCLHTRLSKWCRLAGEGREGQYAWVLDSPI 584

Query: 583 DDLNLDS-QFIGYDMTDFLDNEEI-RRPLMM--------YLFNRILDLIDGRRIIIVIDE 632
           +  N  + + + +D T  L N+   + P +M        Y+   + +   G  ++ V+ E
Sbjct: 585 NQFNAQTYRRLAFDCTQLLKNDYADKHPEVMEAFLNTLFYMKREMHEARPGNLLLNVVAE 644

Query: 633 FWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQ 692
           +W  L   S     ++ L++ R +  +++  TQ P+ AL +  A  +I+Q  T I+ PN+
Sbjct: 645 YWAPLSFKSTADAIKEVLQSGRMRGEILIMDTQYPEQALATPYAAAVIQQVITPIWLPNK 704

Query: 693 KANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRG-MNDEIAILSG 751
            A  + Y + F +T + FE ++ ++   SR  +++QG  +V  ++ L G +   + +LS 
Sbjct: 705 NAQAESYAK-FGVTGKLFEAVR-DMGPLSREMVVQQGHQTVKLKMELDGPLKYWLPLLSA 762

Query: 752 TTKNIELVNQIINDY-GADPDTWLPIF 777
           T KN+ +  +I       DP  W+  F
Sbjct: 763 TQKNLAVAERIRQHLRTTDPTVWVDAF 789
>aph:APH_0419 type IV secretion system protein VirB4, truncation
          Length = 277

 Score =  172 bits (437), Expect = 2e-41
 Identities = 101/276 (36%), Positives = 156/276 (56%), Gaps = 3/276 (1%)

Query: 509 WVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRW 568
           W   L TT    +T  +   I  AI     L    R L  L  F     ++ +A R+  W
Sbjct: 3   WFKLLATTLSDKLTPDDILRIDDAIEGNFKLKKEDRKLRNLVPFLGIGGEDTLASRMMMW 62

Query: 569 IKGNDLGWVFDNDQDDLNLD-SQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRII 627
                   +FDND+D L+   S+  G++M   L +     P ++YLF++I   +DG   +
Sbjct: 63  HSEGSHAALFDNDEDVLDFTKSRVFGFEMGYLLKDPMALAPTLLYLFHKISISLDGTPSM 122

Query: 628 IVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQI 687
           I++DE W  +++  F    +D LK +RK N  ++FATQS +DA  S I+ T+++Q  TQI
Sbjct: 123 IILDEAWALIDNPVFAPRIKDWLKVLRKLNTFVIFATQSVEDASKSQISDTLVQQTATQI 182

Query: 688 FFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIA 747
           F PN KA    Y + F LTERE+ LI+      +R FL+KQG ++VVA ++LRG++D I 
Sbjct: 183 FLPNLKAT-SAYRDVFMLTEREYSLIK-YTDPGTRFFLVKQGVSAVVARIDLRGLDDTIN 240

Query: 748 ILSGTTKNIELVNQIINDYGADPDTWLPIFHQRREN 783
           +LSG  + + ++ +I+ + G DP+ WLPIF+QR +N
Sbjct: 241 VLSGRAETVAILREIMEEVGDDPNVWLPIFYQRVKN 276
>rle:pRL80139 trbE; putative conjugal transfer protein TrbE
          Length = 811

 Score =  171 bits (432), Expect = 8e-41
 Identities = 179/811 (22%), Positives = 335/811 (41%), Gaps = 72/811 (8%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           + +PY   V+  ++ L    LM      G + ++A     N L  Q+N++L  +    + 
Sbjct: 16  DLVPYAGLVDNGILLLKDGSLMAGWYFAGPDSESATDFERNELSRQINSILSRLGTGWM- 74

Query: 72  LYSHIIRRRETIYP--ESRFFSSFAATLDEKYKKKMVSQEL--YRNDLFVSLLWNPTSGK 127
           +    +R   T YP  E   F      L +  +++   QE   + +   + L + P   +
Sbjct: 75  IQVEAVRVPTTEYPSAERSHFPDAVTLLIDHERRRHFGQERGHFESRHALILTYRPPERR 134

Query: 128 TEQLASFFQRLTKAKKTQ-SEPDMEAIRK-IEELSQDLIQGLESYEARLLSVYAHEGIL- 184
              L  +     +++  + ++  ++A R+ I E+ Q L   L     +   V   +G   
Sbjct: 135 RSGLTRYIYSDNESRSAKYADTALDAFRRSIREIEQYLGNVLSVQRMQTREVSERDGARV 194

Query: 185 --FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             + E  +F+   + G    + L        +Y D +   +    +      RF+G+   
Sbjct: 195 ARYDELFQFIRFAITGENHPVRLP----EIPMYLDWLATAELEHGLTPRVEGRFLGVIAI 250

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVF--KSKAAARVIMGRK--------------Q 286
              P+++ PG+ + L   P  +  +  F+F    +A  R+   RK              Q
Sbjct: 251 DGLPAESWPGILNSLNLMPLTYRWSSRFIFLDAEEAKQRLERARKKWQQKVRPFFDQLFQ 310

Query: 287 NQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLT 346
            Q  +    A + +   ++A+ +  S     G +   + +F +    L E     R  + 
Sbjct: 311 TQSRSVDQDAMAMVAETEDAIAEASSQLVAYGYYTPVIVLFDESRSALQEKAEAVRRLIQ 370

Query: 347 NGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGA 406
             G     E L    A+   LPGN+    R   I +RN A L P +S         VW  
Sbjct: 371 AEGFGARIETLNATDAFLGSLPGNWYCNIREPLINTRNLADLVPLNS---------VWSG 421

Query: 407 ------------AVALLKTQAGS-PYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQ 453
                       A  L++  +GS P+  N H  D+G+T + GP+GSGK+ ++  + AQ  
Sbjct: 422 QPFAPCPFYPPDAPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLALIAAQFC 481

Query: 454 KHNPTMVF-FDKDQGAEIFVRAGGGKYKPL--KNGQPTGIA--PLKGMEYTEKNKIFLRS 508
           ++    VF FDK           GG +  +  ++G+   +A  PL  +  T+ ++ +   
Sbjct: 482 RYEKAQVFAFDKGNSMLTLTLGVGGDHYEIGGESGEGASLAFCPLSELS-TDADRAWASE 540

Query: 509 WVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRW 568
           W+  LV+ +G T+    R  I++ I  + S P       +L  F        I   L  +
Sbjct: 541 WIETLVSLQGVTIAPDHRNAISRQIGLMASAPGR-----SLSDFVSGVQMREIKDALHHY 595

Query: 569 IKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDGRRII 627
                +G + D ++D L L  +F  +++   ++  E    P++ YLF RI   +DG   +
Sbjct: 596 TVDGPMGLLLDAEEDGLTL-GRFQCFEIEQLMNMGERNLVPVLTYLFRRIEKRLDGSPSL 654

Query: 628 IVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQI 687
           IV+DE W  L    F+   ++ LK +RK N  ++ ATQS  DA  S I   + E CPT+I
Sbjct: 655 IVLDEAWLMLGHPVFRDKIREWLKVLRKANCAVILATQSISDAERSGIIDVLKESCPTKI 714

Query: 688 FFPN---QKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMND 744
             PN   ++   +++ E      R+ E++ + + +  R + +       + +++L  +  
Sbjct: 715 CLPNGAARETGTREFYERIGFNARQIEIVANAIPK--REYYVTSPDGRRLFDMSLGPVTL 772

Query: 745 EIAILSGTTKNIELVNQIINDYGAD-PDTWL 774
                SG   ++  +  + + +G + P  WL
Sbjct: 773 SFVGASGKA-DLARIRALSSTHGLEWPGQWL 802
>nha:Nham_4566 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 817

 Score =  169 bits (429), Expect = 2e-40
 Identities = 172/759 (22%), Positives = 313/759 (41%), Gaps = 75/759 (9%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           + +P+   V   ++ L    LM      G + +++     N +  Q+NT+L  +    + 
Sbjct: 16  DLVPHAGLVANGIVLLKDGSLMAGWYFAGPDSESSTDAERNEVSRQINTILSRLGSGWM- 74

Query: 72  LYSHIIRRRETIYP---ESRFFSSFAATLDEKYKKKMVSQE-LYRNDLFVSLLWNPTSGK 127
           +    +R   T YP   +  F       +D++ + +  ++   + +   + L W P   +
Sbjct: 75  IQVEAVRVPTTDYPARQDCHFPDPVTRAIDDERRARFEAERGHFESRHAIILTWRPPERR 134

Query: 128 TEQLASFF-----QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
              LA +       R      T  E    AIR+IE+    ++  ++  E R   V   +G
Sbjct: 135 RAGLARYIYSDVESRSASYADTAIETFQNAIREIEQYLASVLS-IQRMETR--EVDERDG 191

Query: 183 IL---FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGM 239
                + E  +F+   + G  E  P+    I   +Y D +   +    +      RF+G+
Sbjct: 192 TRVARYDELFQFIRFCITG--ENHPVRLPDIP--MYLDWLATAELQHGLSPMVENRFLGV 247

Query: 240 FGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQ-----------NQ 288
                +P+++ PG+ + L   P  +  +  F+F     AR  + R +           +Q
Sbjct: 248 VAIDGFPAESWPGILNSLDLMPLTYRWSSRFMFLDDQDARQKLERTRKKWQQKVRPFIDQ 307

Query: 289 MINAADR-----ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARA 343
           +     R     A++ +   ++A+ +  S     G +   + +F D    L E     R 
Sbjct: 308 LFQTQSRSIDQDAAAMVAETEDAIAEASSQLVAYGYYTPVIVLFDDNSTRLQEKTEAVRR 367

Query: 344 HLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNV 403
            +   G     E L    A+   LPGN+    R   I +RN A L P ++         V
Sbjct: 368 LIQAEGFGARIETLNATEAFLGSLPGNWYANIREPLINTRNLADLIPLNA---------V 418

Query: 404 WGAAVA------------LLKTQAGS-PYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLA 450
           W  +              L++  +GS P+  N H  D+G+T V GP+GSGK+ ++  + A
Sbjct: 419 WSGSPTAPCPFYPPNSPPLMQVASGSTPFRMNLHVDDVGHTLVFGPTGSGKSTLLALIAA 478

Query: 451 QLQKHNPTMVF-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIA-----PLKGMEYTEKNKI 504
           Q +++    +F FDK +       A GG +  +      G A     PL  +  T+ ++ 
Sbjct: 479 QFRRYAGAQIFAFDKGRSMMPLTLAAGGDHYEIGGDDADGSAALAFCPLSDLS-TDTDRA 537

Query: 505 FLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIR 564
           +   W+  LV  +G T+T   R  I++ I  +     A+    +L  F        I   
Sbjct: 538 WASEWIETLVAVQGVTITPDHRNAISRQIGLM-----AEARGRSLSDFVSGVQMREIKDA 592

Query: 565 LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDG 623
           L  +     +G + D + D L L S F  +++   ++  E    P++ YLF RI   + G
Sbjct: 593 LHHYTVDGPMGQLLDAESDGLELGS-FQTFEIEQLMNMGERNLVPVLTYLFRRIEKRLTG 651

Query: 624 RRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQC 683
              +I++DE W  L    F+   ++ LK +RK N  +L ATQS  DA  S I   + E C
Sbjct: 652 APSLIILDEAWLMLGHPVFRDKIREWLKVLRKANCAVLLATQSISDAERSGIIDVLKESC 711

Query: 684 PTQIFFPN---QKANYKDYVEDFKLTEREFELIQSELSR 719
           PT+I  PN   ++   + + E     +R+ E++ + + +
Sbjct: 712 PTKICLPNGAAREPGTRKFYERIGFNDRQIEIVATAVPK 750
>ret:RHE_PA00175 trbE; conjugal transfer protein E; K03199 type IV secretion system
           protein VirB4
          Length = 818

 Score =  167 bits (424), Expect = 7e-40
 Identities = 169/748 (22%), Positives = 307/748 (41%), Gaps = 53/748 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           + +PY   V+  V+ L    L+      G + ++A     N L  Q+NT+L  +    + 
Sbjct: 16  DLVPYAGLVDNGVLLLKDGSLIAGWYFAGPDSESATDLERNELSRQINTILSRLGSGWM- 74

Query: 72  LYSHIIRRRETIYPES---RFFSSFAATLDEKYKKKMVSQE-LYRNDLFVSLLWNPTSGK 127
           +    +R     YP      F       +D + +     ++  + +   + L + P   K
Sbjct: 75  IQVEAVRIPTFDYPSDDRCHFPDPVTRAIDAERRAHFAREQGHFESKHALVLTYRPLESK 134

Query: 128 TEQLASF-FQRLTKAKKTQSEPDM----EAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
              L+ + +      KKT ++  +     A+R+IE+   + +  +   E R       E 
Sbjct: 135 KTALSKYIYSDEESRKKTYADTVLFIFKNAVREIEQYFANTLS-IRRMETRETVERGGER 193

Query: 183 IL-FSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFG 241
           +  + E  +F+   V G    I L      + +Y D +   +    +  +   RF+G+  
Sbjct: 194 VARYDELLQFVRFCVTGENHPIRLP----DAPMYLDWLATAELEHGLTPKVENRFLGVVA 249

Query: 242 WKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRK---------------- 285
               P+++ PG+ + L   P  +  +  F+F     AR  + R                 
Sbjct: 250 IDGLPAESWPGILNSLDLMPLTYRWSSRFIFLDAEEARQKLERTRKKWQQKVRPFFDQLF 309

Query: 286 QNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHL 345
           Q Q  +    A + +   ++A+    S     G +   + +F    + L E     R  +
Sbjct: 310 QTQSRSVDQDAMTMVAETEDAIAQASSQLVAYGYYTPVIVLFDHDREALQEKAEAIRRLI 369

Query: 346 TNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSF----PIGKLEG 401
              G     E L    A+   LPGN+    R   I + N A L P +S     PI     
Sbjct: 370 QAEGFGARIETLNATDAFLGSLPGNWYCNIREPLINTSNLADLVPLNSVWSGNPIAPCPF 429

Query: 402 NVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF 461
               +   +      +P+  N H  D+G+T + GP+GSGK+ ++  + AQ +++    +F
Sbjct: 430 YPPNSPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLALIAAQFRRYERAQIF 489

Query: 462 -FDKDQGAEIFVRAGGGKYKPL-----KNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVT 515
            FDK         A GG +  +     +  +     PL  +   + ++ +   W+  LVT
Sbjct: 490 AFDKGSSLLPLTLAAGGDHYEIGGDHNETERALAFCPLSELS-NDADRAWATGWIEMLVT 548

Query: 516 TEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLG 575
            +G  +T   R  I++ I  + S   A RSL     F        I   L  +     +G
Sbjct: 549 LQGVAITPDHRNAISRQIGLMASA--AGRSLSD---FVSGVQMREIKDALHHYTVDGPMG 603

Query: 576 WVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFW 634
            + D +QD L+L + F  +++   ++  E    P++ YLF RI   +DG   +IV+DE W
Sbjct: 604 QLLDAEQDGLSLGA-FQTFEIEQLMNMGERNLVPVLTYLFRRIEKRLDGSPSLIVLDEAW 662

Query: 635 KALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPN--- 691
             L    F++  ++ LK +RK N  ++ ATQS  DA  S I   + E CPT+I  PN   
Sbjct: 663 LMLGHPVFRSKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPNGAA 722

Query: 692 QKANYKDYVEDFKLTEREFELIQSELSR 719
           ++A  +++ E     ER+ E++ + + +
Sbjct: 723 REAGTREFYERIGFNERQIEIVSNAIPK 750
>aph:APH_1129 virB4-2; type IV secretion system protein VirB4
          Length = 777

 Score =  160 bits (404), Expect = 1e-37
 Identities = 166/783 (21%), Positives = 330/783 (42%), Gaps = 42/783 (5%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           EY+    H + + +      L+ ++ V     D+A  + + SL + +   + ++ D  VA
Sbjct: 18  EYVTPACHYDDNTLLNKGGELVQIIEV----VDSACADGVQSLRDGIRKCISSVKDPDVA 73

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQ-ELYRNDLFVSLLWNPTSGKTEQ 130
            + + +R ++    E R    F+ TL + YK  +  + E Y N ++V+++    +   + 
Sbjct: 74  FWVYTVREKKKFDLEWRSTGDFSDTLHDVYKSYIDEKYETYDNKVYVAVVVKHLAEGLDG 133

Query: 131 L--ASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFSE 187
           +  A  F R+    K+        +  + +    ++  L  +  + L +    +G   SE
Sbjct: 134 MVNALLFSRVMSKHKSYLAKRASYLTTVTD---KIMGDLSDFSTKKLGLIDCGDGRWRSE 190

Query: 188 QSEFLHQLVGGRRERIPLTFGTIASTIYSDRVI-FGKEMIEIRHESNERFVGMFGWKEYP 246
             EFL  LV  R     L     A T+ +   +  G    ++      R+  + G K + 
Sbjct: 191 LLEFLSYLVTFRHRECYLETCDNAHTVSAGCDLHMGFNAFKVIDNEKVRYGAILGVKVHA 250

Query: 247 SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEA 306
           S+    + D  L    EFI+ +   F      + + GR+   +  + D   +++  L   
Sbjct: 251 SENLDAV-DACLQQECEFIIVEIIKFTEGRELKKLYGRQAALLEISGDEDLAKLGHLPTI 309

Query: 307 LDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQ 366
           +   +S      E  ++  V AD  ++L   ++   +  +  GA+  R DL +E ++WA 
Sbjct: 310 MQLEDSAYGDCCERQVNCVVIADGLRSLRSGINGMVSAFSTIGALAVRLDLAMEDSFWAL 369

Query: 367 LPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYG 426
           +PGNF Y     A   +        HS+         W  ++ +  +  G PY+FNF   
Sbjct: 370 MPGNFRYVIYMKAALMKKACTFIVLHSYLSFSASSTKWPDSITVFFSNRGLPYFFNFQCT 429

Query: 427 DLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQ 486
             G+T   GP  S  T + NFLL++ ++     V FD    + I+  A GG Y  + +  
Sbjct: 430 GKGHTVCLGPHDSSMTTLSNFLLSEARRLQIRSVVFDYSGKSIIYANAIGGSYHRIDDRP 489

Query: 487 PTGIAPLK--GMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQR 544
               A      +E T  N+      + ++      T  +  RQ +   ++++ ++P  +R
Sbjct: 490 EYVSATFNPFNVEDTAVNRDIAAGVLYRMARPTADT-CDAVRQAVLGVVDAIFAIPMQER 548

Query: 545 SLGALQLFFDNTSKEGIAIR-----LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDF 599
           +            K G  ++     +  W        +   D   +   ++F+G +    
Sbjct: 549 T----------KEKIGECVKVLGGGINSWFGSGRFAHLL-TDSTSIQWHAEFLGINAAML 597

Query: 600 LDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQ--DRLKTIRKQN 657
           +   E    ++ Y+   + + +DG+ +I+V+ E W  L D  F+   +  + +  + K N
Sbjct: 598 VSKTECLSVVLYYIVRSMENHLDGKPLILVMYEAW--LLDFVFETEREFDNWVNGLSKLN 655

Query: 658 GMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSEL 717
            +++FA+++ K   +S +   + +   T+IF PN     K +   F LT+ E + +  ++
Sbjct: 656 VVVVFASENIKAISSSRVIKYVSKHADTRIFMPNFMMGSKQHGRMFGLTQEEQD-VMLQI 714

Query: 718 SRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
           S+    F +KQG  SVV  L+L+    E  IL+    +I ++ + I + G D   W+  F
Sbjct: 715 SQAEGHFFLKQGNASVV--LSLKLPTRESRILTANRTSIRMMYEAIAEKGKD---WIEAF 769

Query: 778 HQR 780
           H +
Sbjct: 770 HDK 772
>rme:Rmet_6305 type IV secretory pathway VirB4 components-like protein
          Length = 818

 Score =  159 bits (402), Expect = 2e-37
 Identities = 177/763 (23%), Positives = 308/763 (40%), Gaps = 67/763 (8%)

Query: 4   MKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLR 63
           +KR  L E   P++  +   +I      L+      GV+ D+AD + + S  +QL+   R
Sbjct: 4   LKRRPLAE-IAPWLTSITPELILNKDGSLLANYEFRGVDADSADASDITSARDQLDQACR 62

Query: 64  NIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNP 123
           +  D R+  +  +  RR   Y +  F +   A LD   +  M +   YRN   +S+ + P
Sbjct: 63  SF-DNRITAWWRLTHRRTKGYVDGEFSNGTDARLDALNRAHMTTGRYYRNAHSLSIAYTP 121

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEP---------------------DMEAIRKIEELSQD 162
            +G    +A FF+++        +P                     DME IR      + 
Sbjct: 122 ETG----VAKFFEKIGHHMTVGGKPIFAALLEATKDTVLARSAFAFDMEKIRSDTRRFEA 177

Query: 163 LIQGLESYEARLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFG 222
           ++        R+          ++   +  +  V  RR R P+T   + + +    +  G
Sbjct: 178 MLDAFTGGIPRIKPTRLAMQDSYAALHQVANPSVPKRRIRFPVTM--LDTHLSESEITVG 235

Query: 223 KEMIEIRHESNERFVGMFGWKEYPSKTRPGMTDGL-LTAPFEFILTQSFVFKSKAAARVI 281
            E +       +R+  +   KE+ S     +   L + A  +  +   F+  ++A A + 
Sbjct: 236 SERLLFESAHGKRYAAIVAVKEWMSFQEAALDTLLQVDAELDICIMYRFLDTARATAYIE 295

Query: 282 MGRKQNQMINAADRA------SSQIDALDE-----------ALDDLESNRFVLGEHHLSL 324
             R+  +M     R+      S + +  DE           AL  L +     G  ++S+
Sbjct: 296 KVRRFYKMAAVNLRSMVQQYMSKEENENDEGREELAKEAGKALKRLTAEGVQHGFANISI 355

Query: 325 AVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRN 384
            V+AD      + +S+    LTN G    RE   L AAW + LPG +  + R   + +  
Sbjct: 356 VVYADTEAECEDAVSEVVGTLTNAGFGAIREKTNLMAAWNSTLPGRWDRQRRLQFVETPA 415

Query: 385 FAALSPFHSFPIGKLEGNVW-----GAAV---ALLKTQAGSPYYFNFHY-GDLGNTFVCG 435
            + ++P  S   G    N W     G  V     L T+  +    + H  G  G+ FV G
Sbjct: 416 VSDIAPVRSVLEGPTR-NDWLSEKTGTEVPPLTCLPTRHRTGQRVDMHQPGGNGHLFVIG 474

Query: 436 PSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPL--KNGQPTGIAPL 493
           P G+GK+V +NFL++Q  +H    + FDKD+   I     GG +  +  K    T + PL
Sbjct: 475 PIGAGKSVFLNFLVSQADRHKARRIRFDKDRSTRIPTLLSGGAFIDVTGKFQASTPVNPL 534

Query: 494 KGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFF 553
             +     +  ++  W+   +  +  +++ Q+ QD+ +A+  L S P  + +L AL    
Sbjct: 535 -SLLADPGSFTYVTEWLTLALEDDDFSLSPQQSQDMFEAVKLLASYPRERWTLSALSTML 593

Query: 554 DNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYL 613
               +E    RLQ W+ G   G  FD+ +D   +           F            Y 
Sbjct: 594 HADLRE----RLQIWLVGGQYGHFFDHVEDAFAVSDNLCIECGELFQKFPRAAALFTDYA 649

Query: 614 FNRILDLIDG-RRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALN 672
           F RI   +DG R  +I ++E     +++ F    +D + TIRK NG +  ATQS +    
Sbjct: 650 FYRISQSMDGIRYTVIEVEECGFFFQNERFYKRFEDWITTIRKLNGAIWAATQSLRQIAR 709

Query: 673 STIAHTIIEQCPTQIFFPNQKANYKD--YVEDFKLTEREFELI 713
                 + E     I+ PN +A      Y + F LT+ + ++I
Sbjct: 710 VANFEILKENIANWIYLPNSQAKTSTDLYGDMFGLTKDQIQMI 752
>bam:Bamb_6632 type IV secretion/conjugal transfer ATPase, VirB4 family
          Length = 852

 Score =  155 bits (393), Expect = 3e-36
 Identities = 148/616 (24%), Positives = 274/616 (44%), Gaps = 52/616 (8%)

Query: 154 RKIEELSQDLIQGLESYEARLLSVYAHEG--ILFSEQSEFLHQLVGGRRERIPLTFGTIA 211
           R+I  L   L   ++    R   V + EG  +   +   +L   V G    + L     +
Sbjct: 194 REITSLESRLSSAVKMTRLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLP----S 249

Query: 212 STIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSF 270
           + +Y D VI G+E+   +  +   +F+ +   + +P ++ PG+   L   P E+  +  F
Sbjct: 250 NPMYLDAVIGGQELWGGVVPKIGRKFIQVVAIEGFPLESTPGVLSALAELPSEYRWSSRF 309

Query: 271 VF---------------KSKAAARVIMGRKQNQMINAADR-ASSQIDALDEALDDLESNR 314
           +F               K K   R    +  N    + ++ A++ +   + A+ ++ S  
Sbjct: 310 IFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQDAAAMVGDAEAAIAEVNSGL 369

Query: 315 FVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR-EDLGLEAAWWAQLPGNFSY 373
              G ++ S+ V  D+ +  +   +       N  A  AR E +    A+   LPG+   
Sbjct: 370 VAAG-YYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLGSLPGHGVE 428

Query: 374 RARSGAITSRNFAALSPFHSFPIGKLEGNV-----WGAAVALLKTQAGSPYYFNFHYGDL 428
             R   I + N A L P  S   G              A+    T   +P+  N H  DL
Sbjct: 429 NVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDL 488

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGG------GK---- 478
           G+TF+ GP+G+GK+  +  + AQL+++   M  +  D+G  ++  A G      GK    
Sbjct: 489 GHTFMFGPTGAGKSTHLGIIAAQLRRY-AGMSIYAFDKGMSMYPLAAGIRAATKGKSGLH 547

Query: 479 YKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLES 538
           +    +       PL+ +E T+ ++ +   W+  ++   G   T  +R +I  AI S+  
Sbjct: 548 FTVAADDDRLAFCPLQFLE-TKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSM-- 604

Query: 539 LPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTD 598
             HA  +   L  F      E I   ++++     +G + D ++D L+L S F  +++ +
Sbjct: 605 --HASGAR-TLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSL-SDFTVFEIEE 660

Query: 599 FLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQN 657
            ++  E+   P+++YLF RI   + G+  +I++DE W  L   +F+A  ++ LK +RK N
Sbjct: 661 LMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLMLGHPAFRAKIREWLKVLRKAN 720

Query: 658 GMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFK---LTEREFELIQ 714
            ++L ATQS  DA NS I   I+E   T+IF PN  A  +D    ++   L  R+ E++ 
Sbjct: 721 CLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMGLNARQIEILA 780

Query: 715 SELSRESRRFLIKQGQ 730
           + + +    ++ + G+
Sbjct: 781 TAIPKRQYYYVSENGR 796
>reu:Reut_D6505 CagE, TrbE, VirB component of type IV transporter system; K03199
           type IV secretion system protein VirB4
          Length = 852

 Score =  155 bits (393), Expect = 3e-36
 Identities = 148/616 (24%), Positives = 274/616 (44%), Gaps = 52/616 (8%)

Query: 154 RKIEELSQDLIQGLESYEARLLSVYAHEG--ILFSEQSEFLHQLVGGRRERIPLTFGTIA 211
           R+I  L   L   ++    R   V + EG  +   +   +L   V G    + L     +
Sbjct: 194 REITSLESRLSSAVKMTRLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLP----S 249

Query: 212 STIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSF 270
           + +Y D VI G+E+   +  +   +F+ +   + +P ++ PG+   L   P E+  +  F
Sbjct: 250 NPMYLDAVIGGQELWGGVVPKIGRKFIQVVAIEGFPLESTPGVLSALAELPSEYRWSSRF 309

Query: 271 VF---------------KSKAAARVIMGRKQNQMINAADR-ASSQIDALDEALDDLESNR 314
           +F               K K   R    +  N    + ++ A++ +   + A+ ++ S  
Sbjct: 310 IFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQDAAAMVGDAEAAIAEVNSGL 369

Query: 315 FVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR-EDLGLEAAWWAQLPGNFSY 373
              G ++ S+ V  D+ +  +   +       N  A  AR E +    A+   LPG+   
Sbjct: 370 VAAG-YYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLGSLPGHGVE 428

Query: 374 RARSGAITSRNFAALSPFHSFPIGKLEGNV-----WGAAVALLKTQAGSPYYFNFHYGDL 428
             R   I + N A L P  S   G              A+    T   +P+  N H  DL
Sbjct: 429 NVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDL 488

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGG------GK---- 478
           G+TF+ GP+G+GK+  +  + AQL+++   M  +  D+G  ++  A G      GK    
Sbjct: 489 GHTFMFGPTGAGKSTHLGIIAAQLRRY-AGMSIYAFDKGMSMYPLAAGIRAATKGKSGLH 547

Query: 479 YKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLES 538
           +    +       PL+ +E T+ ++ +   W+  ++   G   T  +R +I  AI S+  
Sbjct: 548 FTVAADDDRLAFCPLQFLE-TKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSM-- 604

Query: 539 LPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTD 598
             HA  +   L  F      E I   ++++     +G + D ++D L+L S F  +++ +
Sbjct: 605 --HASGAR-TLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSL-SDFTVFEIEE 660

Query: 599 FLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQN 657
            ++  E+   P+++YLF RI   + G+  +I++DE W  L   +F+A  ++ LK +RK N
Sbjct: 661 LMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLMLGHPAFRAKIREWLKVLRKAN 720

Query: 658 GMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFK---LTEREFELIQ 714
            ++L ATQS  DA NS I   I+E   T+IF PN  A  +D    ++   L  R+ E++ 
Sbjct: 721 CLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMGLNARQIEILA 780

Query: 715 SELSRESRRFLIKQGQ 730
           + + +    ++ + G+
Sbjct: 781 TAIPKRQYYYVSENGR 796
>dps:DPPB14 trbE; probable conjugal transfer protein TrbE; K03199 type IV
           secretion system protein VirB4
          Length = 904

 Score =  155 bits (391), Expect = 5e-36
 Identities = 179/805 (22%), Positives = 339/805 (42%), Gaps = 62/805 (7%)

Query: 14  IPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALY 73
           + Y   V+  +I       +     + ++  ++  N L SL    N  ++ + D    ++
Sbjct: 113 LQYCACVDDGIILNKDGSFLAGWEYQSIDTASSTNNELASLTAFFNNGVKTLGDGWT-IH 171

Query: 74  SHIIRRRETIYPE---SRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQ 130
              +R +   YP    S F       ++E+ ++   S   Y     + + + P    TE+
Sbjct: 172 VDAVRIKADFYPPRSASHFPDLVTEAIEEERREIFESGIHYETKHVIFVTYKPNL-TTEK 230

Query: 131 LASFFQRLTKAKKTQSEPDMEAIRKIEELS--QDLIQGLESYEA------RLLSVYAHEG 182
           L+SF  +    K+ Q + +      ++ LS  Q+ +  +E   +      RLL     + 
Sbjct: 231 LSSFAYK----KQLQEKGNKAGRESLKALSFFQNALNEIEDVLSTAVRLTRLLDYTTEDE 286

Query: 183 I----LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIE-IRHESNERFV 237
                ++S+    +   V G  +  P+   T+   +Y D  I  ++++  +  +  E  +
Sbjct: 287 TGTEHIYSKLLSHIQFSVTGVEQ--PIKLPTVP--MYLDTTIGSQDLVGGLVPKIGENHL 342

Query: 238 GMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQ----NQMINAA 293
            + G   +P  + P + + L +    +     F+   +  A+  + + +     ++IN  
Sbjct: 343 AVIGIDGFPQDSYPMIFNVLDSLSISYRFNSRFICMDQYTAQTTLNKYRATWAQKIINPL 402

Query: 294 DR------------ASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKA 341
           D+            AS      +EAL D ++     G +  ++ +  +  + L +   + 
Sbjct: 403 DKIFNKANPKVNRDASVMASDTEEALHDEQAGFVSHGFYSANIIISNENQEQLEDACREI 462

Query: 342 RAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEG 401
           R  L   G    RE +    AW    PGN     R   I + N + L P  S   G    
Sbjct: 463 RRSLQGIGFGCRRETINCLEAWLGSHPGNSYSNIRQVLINTLNLSHLLPLSSIWTGHTYN 522

Query: 402 N-----VWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKH- 455
                 V    +    T   +P+  N H GDLG+T + GP+GSGK+ +++ L AQ +++ 
Sbjct: 523 PSPFFPVNSPPLLYAATNGSTPFRLNLHVGDLGHTLIFGPTGSGKSTLLSTLCAQFRRYA 582

Query: 456 NPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPT-GIAPLKGMEYTEKNKIFLRSWVLKLV 514
           N  +  FDK       V A  G +  +     T    PL+ +  T  ++ +   ++ +LV
Sbjct: 583 NSNIFIFDKGMSMYPLVSAAEGTHYNIGADDSTLAFCPLQHVS-TPASEAWACEYIEQLV 641

Query: 515 TTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDL 574
           T +G TV    R  I  AI  + S P   RSL  L   F    +  +   L  +     +
Sbjct: 642 TMQGVTVKPNHRIAIHDAIQQISSSPENMRSLSNL---FHYIQEPELKEALVHYTNNGPM 698

Query: 575 GWVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVIDEF 633
           G + D + D++++ S F  ++M + ++  EE   P+++YLF+ I     G+  I+V+DE 
Sbjct: 699 GRLLDAESDNISM-SNFTVFEMEELMNMGEENLIPVLLYLFHLIEKSFKGQPSILVLDEA 757

Query: 634 WKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQK 693
           W       F+   ++ LK +RK N  ++ ATQS  DA +S I   + E C T+I+ PN  
Sbjct: 758 WIMFSHPVFRKKIREWLKVLRKANCAVIMATQSLSDAKSSGIMDVLNESCQTKIYLPNIT 817

Query: 694 ANYKDYVEDF---KLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILS 750
           A  +     +    L  R+ E+I +  +R  R + I   +   +  L+L  +    A  S
Sbjct: 818 ATNETEAAMYYGLGLNTRQIEIIAT--ARPKREYYIVSPEGRRLINLSLGPVALSFAGAS 875

Query: 751 GTTKNIELVNQIINDYG-ADPDTWL 774
            + ++I+ + ++  ++G   P  WL
Sbjct: 876 -SKEDIKEIKELEKEHGHVWPKAWL 899
>eba:p2B4 trbE; TrbE protein of DNA transfer system; K03199 type IV secretion
           system protein VirB4
          Length = 845

 Score =  155 bits (391), Expect = 5e-36
 Identities = 132/549 (24%), Positives = 249/549 (45%), Gaps = 37/549 (6%)

Query: 211 ASTIYSDRVIFGKEMIE-IRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQS 269
           ++ +Y D VI G+E+   +       FV +   + +P ++ PG+   L   P E+  +  
Sbjct: 249 SNPVYLDAVIGGQELWGGVVPRIGRNFVQVVAIEGFPLESTPGLLTALGELPCEYRWSSR 308

Query: 270 FVF---------------KSKAAARVIMGRKQNQMINAADR-ASSQIDALDEALDDLESN 313
           F+F               K +   R    +  N      D+ A S +   + A+ ++ S 
Sbjct: 309 FIFMDPHEAVKHLDKFRKKWRQKVRGFFDQVFNTHTGPVDQDALSMVGDAEAAIAEVNSG 368

Query: 314 RFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR-EDLGLEAAWWAQLPGNFS 372
              +G +   + +  D+ +  +E  ++      N     AR E +    A+   LPG+  
Sbjct: 369 LVAVG-YFTGVVILMDENRDKLEESARLVEKSINRLGFAARIETINTLDAFLGSLPGHGV 427

Query: 373 YRARSGAITSRNFAALSPFHSFPIGKLEGNV-----WGAAVALLKTQAGSPYYFNFHYGD 427
              R   I + N A L P  S   G  +           A+    T   +P+  N H  D
Sbjct: 428 ENVRRPLINTMNLADLLPTSSIWTGHADAPCPLYPPLSPALMHCVTHGATPFRLNLHVRD 487

Query: 428 LGNTFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGG-KYKPLKNG 485
           +G+TF+ GP+G+GK+  +  + AQL+++   T+  FDK        +A GG  +    + 
Sbjct: 488 IGHTFMFGPTGAGKSTHLALIAAQLRRYAGMTLYAFDKGMSLYPLTKAVGGLHFSVAADD 547

Query: 486 QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRS 545
                 PL+ ++ T+ ++ +   W+  ++   G   T  +R +I  AI S+       R+
Sbjct: 548 DRLAFCPLQFLD-TKGDRAWAMEWIDTILALNGVETTPAQRNEIGHAIMSMHR--SGGRT 604

Query: 546 LGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLD-NEE 604
           L  L +   +   E I   ++++     +G + D ++D L+L + F  +++ + +D  E+
Sbjct: 605 LSELSVTIQD---EAIREAIRQYTVDGTMGHLLDAEEDGLSL-ADFTTFEIEELMDLGEK 660

Query: 605 IRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFAT 664
              P+++YLF RI   + G+  +I++DE W  L   +F+A  ++ LK +RK N ++L AT
Sbjct: 661 YALPVLLYLFRRIERSLKGQPAVIILDEAWLMLGHPAFRAKIREWLKVLRKANCLVLMAT 720

Query: 665 QSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFK---LTEREFELIQSELSRES 721
           QS  D  NS I   I+E   T+IF PN  A  +D    ++   L  R+ E++ + + +  
Sbjct: 721 QSLSDVANSGILDVIVESTATKIFLPNVYACDQDTAALYRRMGLNARQIEILATAIPKRQ 780

Query: 722 RRFLIKQGQ 730
             ++ + G+
Sbjct: 781 YYYVSESGR 789
>pol:Bpro_5465 type IV secretory pathway VirB4 components-like
          Length = 850

 Score =  152 bits (384), Expect = 3e-35
 Identities = 164/792 (20%), Positives = 330/792 (41%), Gaps = 89/792 (11%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           E +P+   +   ++      L+ +   +G++  + + +  +   N +   LR   D  + 
Sbjct: 20  ELVPWFGQITPGLVICMDGSLLAMFEYDGIDLQSTEGDQHDQASNSMEIALRAFDDRNIG 79

Query: 72  LYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQL 131
            + ++ +RR T    +   +  A  +D+ +++ +    L     ++++ + P  G     
Sbjct: 80  WF-YVDKRRRTFLGAATGENVVARGVDDAWRESVDDGSLSEIRHYIAIAFRPFRGTM--- 135

Query: 132 ASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEF 191
             FF  ++     +      AI K       + +G+E  + +++   A      S+ S F
Sbjct: 136 -GFFDEISSTMMDEHRSLPAAIAKTISSKLRMEKGIEKMQGKIIGATA---AFESQISSF 191

Query: 192 LHQLVGGRRERI---------------------------PLTFGTIASTIYSDRVIFGKE 224
           +  L      R+                           P    T+  T    R   G  
Sbjct: 192 MGTLTTLNARRLTDQELLCSLSDRVNLATPRTKVSCGPLPSYLNTLLVTDTLKRADGG-- 249

Query: 225 MIEIRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR 284
           ++E    +  +FV M   K  P        + LL+   +F + Q + F  +  A+  +  
Sbjct: 250 ILEFVGATRSQFVQMLSVKGLPQVINNEDVEALLSLQGDFSVVQQYRFLDREKAKAYIND 309

Query: 285 KQNQ--------MINAADRAS-SQIDALD-----------EALDDLESNRFVLGEHHLSL 324
            ++         M  A +R S ++ D++D            AL +L  +    G H +++
Sbjct: 310 CEHHYRSSIKSPMTQAFERLSGNESDSIDMGMLALAEDSSAALAELTGDGVNFGYHTMAV 369

Query: 325 AVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRN 384
                  + L   L       +N G  + RE +    A+ A +PG      R+  +++RN
Sbjct: 370 MAIGRDRRDLDITLKGIAGLYSNLGYGVVREVVNQVGAFCATIPGGGDSTVRTSMVSTRN 429

Query: 385 FAALSPFHSFPIGKLEGNVWGA-------AVALLKTQAGSPYYFNFHYGDLGNTFVCGPS 437
            + +S   S   G  +             A+ L  T +G P YFNFH GD+G+  + G +
Sbjct: 430 LSDMSLVRSIKSGSSQNEYLTEQLGSPQEALCLFPTTSGVPEYFNFHVGDVGHFAIIGGT 489

Query: 438 GSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTG-IAPLKG 495
           G+GKT ++N L+   QK+     +  DKD+   I +++ GG Y  +   +    + PL+ 
Sbjct: 490 GAGKTTLLNLLIMMWQKYRGARTIVIDKDESCFITIKSMGGSYISIDPEKARAKMNPLRW 549

Query: 496 MEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFD 554
           ++    +   + SW+   ++  G + +T Q+   I + I+ L +    + +LG      +
Sbjct: 550 IK-NPNSWAKVASWIEGAMSVYGNEAITAQQSTLITQVISQLATREPHRHTLGNFHAQLN 608

Query: 555 NTSKEGIAIRLQRWI----------KGNDLGWVFDNDQD----DLNLDSQ-FIGYDMTDF 599
             +++ +A RL  ++           G+    +FD  +D     L  DS   IG D+   
Sbjct: 609 GLNQD-LAARLAPFVAVAGSANTQSSGSKYAHLFDGYEDGFAAQLAADSSGIIGIDVNAL 667

Query: 600 LDNEEIRRPLMMYLFNRILDLIDG-RRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNG 658
           L +E++   ++ YLF  I ++IDG    +I ++E W  L+++ FK   +D L+T+RK+  
Sbjct: 668 LKDEKLAPCVIEYLFMAIDEMIDGLSPTMIYLEEGWYLLQNERFKGVYEDYLRTLRKRRA 727

Query: 659 MMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKAN--YKDYVEDFKLTEREFELIQSE 716
           ++  ATQS  D     ++    +   T+I+ P+ KA    K Y++   LT    +++ + 
Sbjct: 728 IIGLATQSVFDIEKVKLSAAFNDNVRTRIYLPSAKAKSAAKVYIDYLGLTAEHVDVLANA 787

Query: 717 LSRESRRFLIKQ 728
           + +  R ++I+Q
Sbjct: 788 IPK--RHYMIEQ 797
>atc:AGR_pTi_83 conjugal transfer protein TrbE; K03199 type IV secretion system
           protein VirB4
          Length = 822

 Score =  152 bits (383), Expect = 4e-35
 Identities = 169/807 (20%), Positives = 328/807 (40%), Gaps = 59/807 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           + +PY   V+  VI L    LM      G + +++     N +  Q+N +L  +    + 
Sbjct: 16  DLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNEVSRQINMILSRLGSGWM- 74

Query: 72  LYSHIIRRRETIYPES---RFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL-WNPTSGK 127
           +    +R     YP      F       +D + +     +  +       +L W P   +
Sbjct: 75  IQVEALRVPTIDYPAEDACHFPDPVTRAIDAERRSHFERESGHFESRHALILTWRPPEPR 134

Query: 128 TEQLASFF-----QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
              L  +       R      T  +    +IR++E+   +++                  
Sbjct: 135 RSGLTRYVYADAGSRSATYADTALDSFRTSIREVEQYLANVVSIRRMMTQETQERGGFRR 194

Query: 183 ILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             + E  +F+   + G  E  P+    I   +Y D ++  +    +      RF+G+   
Sbjct: 195 ARYDELFQFIRFCITG--ENHPIRLPDIP--MYLDWLVTAELQHGLTPTIENRFLGVVAI 250

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQ-----------NQMIN 291
              P+++ PG+ + L   P  +  +  FVF  +  AR  + R +           +Q+  
Sbjct: 251 DGLPAESWPGILNSLDLMPLTYRWSSRFVFLDEQEARSRLERTRKKWQQKVRPFFDQLFQ 310

Query: 292 AADRASSQIDAL------DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHL 345
              R+  Q DA+      ++A+    S     G +  ++ +F +    L E     R  +
Sbjct: 311 TQSRSVDQ-DAMMMVAETEDAIAQAASQLVAYGYYTPAIILFDEVQPRLQEKCEAIRRLI 369

Query: 346 TNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSF----PIGKLEG 401
              G     E L    A+   LPG      R   + +RN A L P +S     P+     
Sbjct: 370 QAEGFGARIETLNATDAFLGSLPGVSYANIREPLVNTRNLADLIPLNSVWSGNPVAPCPF 429

Query: 402 NVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF 461
              G+   +      +P+  + H  D+G+T V GP+GSGK+ ++  + AQ +++    +F
Sbjct: 430 YPAGSPPLMQVASGSTPFRLSLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQIF 489

Query: 462 -FDKDQGAEIFVRAGGGKYKPLKN---GQPTGIAPLKGM-----EYTEKNKIFLRSWVLK 512
            FDK +       A GG +  +     G+  G +P           T+ ++ +   W+  
Sbjct: 490 AFDKGRSMLPLTLAIGGDHYEIDGDAAGEGEGASPRLAFCPLAELSTDGDRAWAAEWIET 549

Query: 513 LVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGN 572
           LV  +G TVT   R  I++ +  +     A+    +L  F        I   L  +    
Sbjct: 550 LVALQGVTVTPDYRNAISRQLVLM-----AESRGRSLSDFVSGVQMREIKDALHHYTVDG 604

Query: 573 DLGWVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVID 631
            +G + D ++D L L + F  +++ + ++  E    P+++Y+F R+   + G   +I+ID
Sbjct: 605 PMGQLLDAEEDGLALGA-FQCFEVEELMNMGERNLVPVLLYMFRRVEKRLTGAPSLIIID 663

Query: 632 EFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPN 691
           E W  L   +F+   ++ LK +RK N  ++ ATQS  DA  S I   + E CPT+I  PN
Sbjct: 664 EAWLMLGHPTFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPN 723

Query: 692 ---QKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAI 748
              ++   +++ E     ER+ E++ + + +  R + +   +   + +++L  +      
Sbjct: 724 GAAREPGTREFYERIGFNERQIEIVATAMPK--REYYVASPEGRRLFDMSLGPVALSFVG 781

Query: 749 LSGTTKNIELVNQIINDYGAD-PDTWL 774
            SG  ++++ +  + ++ GAD P  WL
Sbjct: 782 ASG-KEDLKSIRALHSENGADWPIHWL 807
>atu:Atu6038 trbE; conjugal transfer protein; K03199 type IV secretion system
           protein VirB4
          Length = 822

 Score =  152 bits (383), Expect = 4e-35
 Identities = 169/807 (20%), Positives = 328/807 (40%), Gaps = 59/807 (7%)

Query: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVA 71
           + +PY   V+  VI L    LM      G + +++     N +  Q+N +L  +    + 
Sbjct: 16  DLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNEVSRQINMILSRLGSGWM- 74

Query: 72  LYSHIIRRRETIYPES---RFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL-WNPTSGK 127
           +    +R     YP      F       +D + +     +  +       +L W P   +
Sbjct: 75  IQVEALRVPTIDYPAEDACHFPDPVTRAIDAERRSHFERESGHFESRHALILTWRPPEPR 134

Query: 128 TEQLASFF-----QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEG 182
              L  +       R      T  +    +IR++E+   +++                  
Sbjct: 135 RSGLTRYVYADAGSRSATYADTALDSFRTSIREVEQYLANVVSIRRMMTQETQERGGFRR 194

Query: 183 ILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGW 242
             + E  +F+   + G  E  P+    I   +Y D ++  +    +      RF+G+   
Sbjct: 195 ARYDELFQFIRFCITG--ENHPIRLPDIP--MYLDWLVTAELQHGLTPTIENRFLGVVAI 250

Query: 243 KEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQ-----------NQMIN 291
              P+++ PG+ + L   P  +  +  FVF  +  AR  + R +           +Q+  
Sbjct: 251 DGLPAESWPGILNSLDLMPLTYRWSSRFVFLDEQEARSRLERTRKKWQQKVRPFFDQLFQ 310

Query: 292 AADRASSQIDAL------DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHL 345
              R+  Q DA+      ++A+    S     G +  ++ +F +    L E     R  +
Sbjct: 311 TQSRSVDQ-DAMMMVAETEDAIAQAASQLVAYGYYTPAIILFDEVQPRLQEKCEAIRRLI 369

Query: 346 TNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSF----PIGKLEG 401
              G     E L    A+   LPG      R   + +RN A L P +S     P+     
Sbjct: 370 QAEGFGARIETLNATDAFLGSLPGVSYANIREPLVNTRNLADLIPLNSVWSGNPVAPCPF 429

Query: 402 NVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF 461
              G+   +      +P+  + H  D+G+T V GP+GSGK+ ++  + AQ +++    +F
Sbjct: 430 YPAGSPPLMQVASGSTPFRLSLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQIF 489

Query: 462 -FDKDQGAEIFVRAGGGKYKPLKN---GQPTGIAPLKGM-----EYTEKNKIFLRSWVLK 512
            FDK +       A GG +  +     G+  G +P           T+ ++ +   W+  
Sbjct: 490 AFDKGRSMLPLTLAIGGDHYEIDGDAAGEGEGASPRLAFCPLAELSTDGDRAWAAEWIET 549

Query: 513 LVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGN 572
           LV  +G TVT   R  I++ +  +     A+    +L  F        I   L  +    
Sbjct: 550 LVALQGVTVTPDYRNAISRQLVLM-----AESRGRSLSDFVSGVQMREIKDALHHYTVDG 604

Query: 573 DLGWVFDNDQDDLNLDSQFIGYDMTDFLD-NEEIRRPLMMYLFNRILDLIDGRRIIIVID 631
            +G + D ++D L L + F  +++ + ++  E    P+++Y+F R+   + G   +I+ID
Sbjct: 605 PMGQLLDAEEDGLALGA-FQCFEVEELMNMGERNLVPVLLYMFRRVEKRLTGAPSLIIID 663

Query: 632 EFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPN 691
           E W  L   +F+   ++ LK +RK N  ++ ATQS  DA  S I   + E CPT+I  PN
Sbjct: 664 EAWLMLGHPTFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPN 723

Query: 692 ---QKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAI 748
              ++   +++ E     ER+ E++ + + +  R + +   +   + +++L  +      
Sbjct: 724 GAAREPGTREFYERIGFNERQIEIVATAMPK--REYYVASPEGRRLFDMSLGPVALSFVG 781

Query: 749 LSGTTKNIELVNQIINDYGAD-PDTWL 774
            SG  ++++ +  + ++ GAD P  WL
Sbjct: 782 ASG-KEDLKSIRALHSENGADWPIHWL 807
>net:Neut_2552 CagE, TrbE, VirB component of type IV transporter system
          Length = 832

 Score =  139 bits (350), Expect = 3e-31
 Identities = 128/537 (23%), Positives = 226/537 (42%), Gaps = 72/537 (13%)

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGR---------- 284
           +F+       +PS + PG+ + L   P  +  +  F+F  K  A   + R          
Sbjct: 242 KFIACVAIDGFPSASEPGILNLLDGLPLAYRWSSRFIFLEKHQAIFSLNRYRLKWRQKIR 301

Query: 285 --------KQNQMIN--AADRASSQIDALDEALDDLESNRF------VLGEHHLSLAVFA 328
                    Q  +IN  A D A+    A+++A   L S  +      ++ E  + L   A
Sbjct: 302 GFWSQVFKSQKGVINTDALDMATQTESAINDAHSGLVSYGYYTPVIVLMHEDRIHLEKQA 361

Query: 329 DQPKTLVEYLS-KARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAA 387
           D  K  ++Y+   AR    N           LEA W   LPG      R   I + N + 
Sbjct: 362 DYVKRQIDYIGFSARIETVNA----------LEA-WLGSLPGQTYPNIRRPLIHTLNLSD 410

Query: 388 LSPFHSFPIGKLEGN-----VWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKT 442
           L P  S   G  +            +    T   +P+  N H GD+G+T + GP+G+GK+
Sbjct: 411 LLPLASIWPGLKQNPCDFFPAGSPPLMQTVTTGATPFRLNLHVGDVGHTLIFGPTGAGKS 470

Query: 443 VIVNFLLAQLQKHNP-----------TMVFFDKDQGAEIFVRAGGGKYKPLKNGQPT--G 489
            ++  + AQ  ++             +++ FD         +A  G +  + N       
Sbjct: 471 TLLALIAAQFSRYQSKPGMDGSKLPASVLVFDYGYSLYTLCKAAQGIHYDIGNDSEEIGA 530

Query: 490 IAPLKGMEYTEKNKIFLRSWVLKLVTTEG-QTVTEQERQDIAKAINSLESLPHAQRSLGA 548
           + PL  ++ +    ++   W+      +  +  T Q++ +I +AI  L + P   RSL  
Sbjct: 531 VMPLADID-SPAGALWAEEWIATCYELQALKPPTPQQKTEIHRAIGLLRAAPMHGRSLTD 589

Query: 549 LQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRR- 607
              F        I   L  +     +G + D  +D + L +QF  +++ + +        
Sbjct: 590 ---FVAQVQDNDIQDALSHYTLKGPMGHLLDGAEDSMEL-AQFTTFEVKELMSMGRANAL 645

Query: 608 PLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSP 667
           P+++YLF RI   + G+ +++ +DE W  L D  ++   ++ LKT+RKQN  ++ ATQS 
Sbjct: 646 PVLLYLFRRIEKTMHGQPVLLALDEAWAMLGDPVWREKVREWLKTLRKQNCSVVLATQSL 705

Query: 668 KDALNSTIAHTIIEQCPTQIFFPNQKANY---------KDYVEDFKLTEREFELIQS 715
            DA+ S +   + EQCPT+I  PN++A+           D    F L +RE E++++
Sbjct: 706 SDAVRSGLLDVLTEQCPTKILLPNKEADQYGTKETPGPADLYTMFGLNKREIEILKN 762
>rfr:Rfer_4260 type IV secretory pathway VirB4 components-like; K03199 type IV
           secretion system protein VirB4
          Length = 831

 Score =  132 bits (331), Expect = 4e-29
 Identities = 168/787 (21%), Positives = 325/787 (41%), Gaps = 73/787 (9%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           +E +PY+   ++  +A   + ++ +   +G++ +       +   N              
Sbjct: 19  QELLPYMCLWDEQTVATLDQGMLALYEYDGLDAEGRSEAETSLAVNAFEQAFSGFGSGST 78

Query: 71  ALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSG---- 126
            ++S++ RR+   YP   F  + A  +D+ ++ K+ S + Y N   +++      G    
Sbjct: 79  -VWSYVDRRKTDAYPRGHFSDNVARFIDQTWQDKVTSTQ-YENKYSLAVHQRANVGTMAL 136

Query: 127 --------KTEQL---ASFFQRLT-----KAKKTQSEPDMEAIRK-IEELSQDLIQGLES 169
                   K E L   A+F + +      KA+++  E  M+A +  +E+    L  G+ +
Sbjct: 137 FDTVDLLVKEEGLGLTAAFGKAIKTQLSLKARRSVDERKMQAAKTALEDKLLSLESGMRN 196

Query: 170 YEARLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIR 229
              R L        L++  S             IP     +++ + SD +    + +   
Sbjct: 197 LGLRRLGEERLMAELYNRVSPASPSRTAYPVPTIP---SFLSNMLCSDSLRRTPDALVFT 253

Query: 230 HESNERFVGMFGWKEYP--SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQN 287
           +E  E++VG+   K +   ++T     D L T   E  +   F F  +  A+  +   + 
Sbjct: 254 NEK-EKYVGVVSLKGFSGNAETVVSQLDWLTTIEGEITVAHCFRFIDRDVAQKTIEDIER 312

Query: 288 QMINAA---------------------DRASSQIDALDEALDDLESNRFVLGEHHLSLAV 326
             I+ +                      R +  +DA    +D  ++NR   G H+L++  
Sbjct: 313 YNISKSVPFFHRMYTTFAKTEPTKFNEGRLAMALDAKAALVDLYQANR-AFGHHNLTVLC 371

Query: 327 FADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFA 386
           F D  + +     +   +L         E +    A+   LPG +    R   ++  N A
Sbjct: 372 FGDTYEEMKRVRQQVVENLKFSRFNGHVERMHQLTAFTQTLPGQWGASVRWNFVSFGNAA 431

Query: 387 ALSPFHSFPIG-------KLEGNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGS 439
            ++P  +   G       + E      A+  + T AG+P + +     +G+  V GP+ +
Sbjct: 432 DIAPIRTLTKGPEKCVHFEKEIKREFPALTSIPTTAGTPAFIDLWERGVGHLKVIGPTRA 491

Query: 440 GKTVIVNFLLAQLQKHNPTM-VFFDKDQGAEIFVRAGGGKYKPL----KNGQPTGIAPLK 494
           GK+   NFLL+Q +K+ P   +  DK+    I      G +  L    KNG  T +APL 
Sbjct: 492 GKSTATNFLLSQFRKYEPCRTIVIDKNYSCRIATLLQDGVHVDLNQSAKNG--TRMAPLS 549

Query: 495 GMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFD 554
            + + E++  FL +WV++L+ + G+        +I +   S+  L    R    L     
Sbjct: 550 LLGH-ERHHGFLVNWVIELIES-GRNGVMCSPAEIDRITQSIRGLAELGRKHWRLHYLAT 607

Query: 555 NTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLF 614
           +   + +   L RWI G   G  FDN+ +++ +  + I ++  D   N+ +    M YLF
Sbjct: 608 SLGPD-LGAYLGRWIAGGADGNWFDNEPEEVEI-GRHICFECQDLFGNKVVAGLAMSYLF 665

Query: 615 NRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNST 674
             I  L+D    I+ I+E W  L+++ F     D L+T+ K+NG +   TQ+ K+    +
Sbjct: 666 YLIEGLLDDSPTIVSIEETWFFLDNEKFAKKIDDFLRTLGKRNGSLWIVTQTMKEIQECS 725

Query: 675 IAHTIIEQCPTQIFFPNQKA--NYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNS 732
           I  +I+   P  I+ P+Q    + + Y+E   L   E + I    + + + + +K    S
Sbjct: 726 IKTSIMSNIPNTIYLPDQNIMNSSELYIEAAGLLPEEIQRIAE--ATDKKHYYLKTPSIS 783

Query: 733 VVAELNL 739
            + +L L
Sbjct: 784 RMLDLEL 790
>ppr:PBPRB1600 hypothetical TrbE protein; K03199 type IV secretion system protein
           VirB4
          Length = 798

 Score =  126 bits (317), Expect = 2e-27
 Identities = 98/361 (27%), Positives = 178/361 (49%), Gaps = 26/361 (7%)

Query: 414 QAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKDQGAEIFV 472
           Q  +P+  N H  D+G+T + GP+G GK+  +  ++AQ  ++    VF FDK +      
Sbjct: 438 QGNTPFRLNLHVEDVGHTLLFGPTGKGKSTALAIMVAQCFRYPNAQVFVFDKKRSMYALS 497

Query: 473 RAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKA 532
           + GG       N  P+  APL  ++   +   +   ++ +L+  +  +VT   R  I  A
Sbjct: 498 QLGGTHIDIGDNSAPS-FAPLCDLDNDFE---WCCDYIEQLLVLQSVSVTPAMRSAIFAA 553

Query: 533 INSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFI 592
           + ++   P     +  L  F        I   ++ +      G + D  +D L+L S F+
Sbjct: 554 LTTMRGSP-----IQTLSEFKAQCQHNEIKTAIEYYTVQGRSGDLLDAQEDTLSLAS-FM 607

Query: 593 GYDMTDFL---DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDR 649
            +++   +   D + I  P++ YLF RI   ++G+   IV+DE W A     F A  ++ 
Sbjct: 608 VFEIDGLMKRGDKDAI--PVLSYLFRRIERSLNGQPSFIVLDEAWVAFSHPIFLAMLKEW 665

Query: 650 LKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKAN-YKDYVEDFKLTER 708
           LK +RK N  ++ ATQS  DA+ S I   ++E CPTQIF PN+KA  + +    F L ++
Sbjct: 666 LKELRKANCAVILATQSLSDAIKSGILDVLVESCPTQIFLPNEKAPLFAETYHQFGLNDK 725

Query: 709 EFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIA---ILSGTTKNIELVNQIIND 765
           + EL++   +   R + + Q   + + +L+L    D IA   + +G+  +I+ V  ++++
Sbjct: 726 QIELLRH--ATPKRDYYVCQPTGNRLIDLSL----DPIALAFVAAGSKDDIQRVKALVHE 779

Query: 766 Y 766
           +
Sbjct: 780 H 780
>hpa:HPAG1_0017 ATPase/DNA transfer protein
          Length = 787

 Score =  123 bits (309), Expect = 2e-26
 Identities = 165/785 (21%), Positives = 326/785 (41%), Gaps = 74/785 (9%)

Query: 21  NQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRR 80
           ++H +   +  L+ ++ +EGV++       L  L  +    L ++      L   +++RR
Sbjct: 38  DEHFLLTKNENLVGILRLEGVSYTHLSTEQLQDLFTERQMALDSLEKVVARL---VVKRR 94

Query: 81  ETIYPESRFFSSFAATLDEKYKKKMVSQ----ELYRNDLFVSLLWNPTSGKTEQLASFFQ 136
           +  + ++          D KY + +++Q    E+Y N  F+ L         E   S   
Sbjct: 95  KIDHQQN-------IQADSKYLQAILNQFENKEVYENQYFLVL---------ESAHSLQG 138

Query: 137 RLTKAKKTQSEPDMEAIRKIEELSQDLIQG-LESYEARLLSVYAHEGILFSEQSEFLHQL 195
            L   KK+    + E  + I       +Q  L+S E +L + YA + +   E   F  + 
Sbjct: 139 VLEHKKKSLMHANRENFKDILSYKAHFLQETLKSLEIQLKN-YAPKLLSSKEVLNFYAEY 197

Query: 196 VGGRRERI-PLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKTRPGMT 254
           + G    + PL  G ++ +  +  + F K+       + + +  + G K Y S+    + 
Sbjct: 198 INGFDLPLKPLVGGYLSDSYIASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIA 257

Query: 255 DGLLT---APFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDLE 311
            G L     P + I    F  +  +  + +   K+    + ++   +++    E +   +
Sbjct: 258 VGALLYQETPLDII----FSIEPMSVHKTLSFLKERAKFSMSNLVKNELLEYQELV---K 310

Query: 312 SNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNF 371
           + R  + +  L++ + A   + L    S     L     V   E  GL+  +++  P   
Sbjct: 311 TKRLSMQKFALNILIKAPSLEDLDAQTSLILGLLFKENLVGVIETFGLKGGYFSFFPERI 370

Query: 372 SYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYFNFHYGDL-- 428
               R   +TS+  A L  F    +G  + N WG + +++ K    SP+ FNFH  ++  
Sbjct: 371 HLNHRLRFLTSKALACLMVFERQNLG-FKANSWGNSPLSVFKNLDYSPFLFNFHNQEVSH 429

Query: 429 ----------GNTFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGG 477
                     G+T + G +GSGK+ +++FL+    K+ N  ++ FD+ QG   F +   G
Sbjct: 430 NNAKEIARVNGHTLIIGATGSGKSTLISFLMMSALKYQNMRLLAFDRMQGLYSFTKFFKG 489

Query: 478 KYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTE--QERQDIAKAINS 535
            Y    +GQ   I P   +E   +N  FL+S+ L ++        E  ++   +  AI S
Sbjct: 490 HYH---DGQSFSINPFY-LEPNLQNLEFLQSFFLSMLDLAPSRDKEALEDMNAVFSAIKS 545

Query: 536 L-ESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGY 594
           L E+L     SL   +     TS   +++ L+ ++       +F+   D LN ++     
Sbjct: 546 LYETLYPKAFSLLDFKETLKRTSSNQLSLSLEPYLNNP----LFNALNDALNSNAFLNVI 601

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRR----IIIVIDEFWKALEDDSFKAFAQDRL 650
           ++     N +    L  YLF +IL+  + R+     ++ +DEF   +E+D         +
Sbjct: 602 NLDTITQNPKDLGLLAYYLFYKILE--ESRKNDSGFLVFLDEFKSYVENDLLNTKINALI 659

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
              RK NG+++ A Q          AH+ +    T I +P + A    +  +  L+E E 
Sbjct: 660 TQARKANGVVVLALQDIYQLSGVKNAHSFLSNMGTLILYPQKNARELKHHFNVPLSETEI 719

Query: 711 ELIQSELSRESRRFLIKQ--GQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA 768
             +++     +R+ L+K     NS + +++L  +   + I +  + ++  V  +  DY  
Sbjct: 720 SFLEN-TPLYARQVLVKNLGNGNSNMIDVSLESLGRYLKIFNSDSSHVNKVKALQKDY-- 776

Query: 769 DPDTW 773
            P  W
Sbjct: 777 -PKEW 780
>hpj:jhp0015 virB4_1; DNA transfer protein; K03199 type IV secretion system
           protein VirB4
          Length = 787

 Score =  122 bits (306), Expect = 3e-26
 Identities = 167/785 (21%), Positives = 325/785 (41%), Gaps = 74/785 (9%)

Query: 21  NQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRR 80
           ++H +   +  L+ ++ +EGV++       L  L  +    L ++      L   +++RR
Sbjct: 38  DEHFLLTKNENLVGILRLEGVSYTHLSTEQLQDLFTERQMALDSLEKVVARL---VVKRR 94

Query: 81  ETIYPESRFFSSFAATLDEKYKKKMVSQ----ELYRNDLFVSLLWNPTSGKTEQLASFFQ 136
           +  Y +S          D +Y + +++Q    E+Y N  F+ L         E   S   
Sbjct: 95  KIDYKQS-------IQSDSQYLQAILNQFENKEVYENQYFLVL---------ESTHSLHG 138

Query: 137 RLTKAKKTQSEPDMEAIRKIEELSQDLIQG-LESYEARLLSVYAHEGILFSEQSEFLHQL 195
            L   KK+    + E  + I       +Q  L+S E +L + YA + +   E   F  + 
Sbjct: 139 VLEHKKKSFMHANRENFKDILSYKAHFLQETLKSLEIQLKN-YAPKLLNSKEVLNFYAEY 197

Query: 196 VGGRRERI-PLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKTRPGMT 254
           + G    + PL  G ++ +  +  + F K+       + + +  + G K Y S+    + 
Sbjct: 198 INGFELPLKPLVGGYLSDSYIASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIA 257

Query: 255 DGLLT---APFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDLE 311
            G L     P + I    F  +  +  + +   K+    + ++   +++    E +   +
Sbjct: 258 VGALLYQETPLDII----FSIEPMSVNKTLSFLKERAKFSMSNLVKNELLEYQELV---K 310

Query: 312 SNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNF 371
           + R  + +  L++ + A   + L    S     L     V   E  GL+  +++  P   
Sbjct: 311 TKRLSMQKFALNVLIKAPSLEDLDAQTSLILGLLFKENLVGVIETFGLKGGYFSFFPERI 370

Query: 372 SYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYFNFHYGDL-- 428
               R   +TS+  A L  F    +G  + N WG + +++ K    SP+ FNFH  ++  
Sbjct: 371 HLNHRLRFLTSKALACLMVFERQNLG-FKANSWGNSPLSVFKNLDYSPFLFNFHNQEVSH 429

Query: 429 ----------GNTFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGG 477
                     G+T V G +GSGK+ ++++L+    K+ N  ++ FD+ QG   F     G
Sbjct: 430 NNAKEIARVNGHTLVIGATGSGKSTLISYLMMSALKYQNMRLLAFDRMQGLYSFTEFFKG 489

Query: 478 KYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTE--QERQDIAKAINS 535
            Y    +GQ   I P   +E   +N  FL+S+ L ++        E  ++   I+ AI S
Sbjct: 490 HYH---DGQSFSINPFC-LEPNLQNLEFLQSFFLSMLDLAPSRDKEALEDMNAISGAIKS 545

Query: 536 L-ESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGY 594
           L E+L     SL   +     TS   + + L+ ++       +F+   D  N ++     
Sbjct: 546 LYETLYPKDFSLLDFKETLKRTSSNQLGLSLEPYLNNP----LFNALNDAFNSNAFLNVI 601

Query: 595 DMTDFLDNEEIRRPLMMYLFNRILDLIDGRR----IIIVIDEFWKALEDDSFKAFAQDRL 650
           ++     N +    L  YLF +IL+  + R+     ++ +DEF   +E+D         +
Sbjct: 602 NLDAITQNPKDLGLLAYYLFYKILE--ESRKNDSGFLVFLDEFKSYVENDLLNTKINALI 659

Query: 651 KTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREF 710
              RK NG+++ A Q          AH+ +    T I +P + A    +  +  L+E E 
Sbjct: 660 TQARKANGVVVLALQDIYQLSGVKNAHSFLSNMGTLILYPQKNARELKHNFNVPLSETEI 719

Query: 711 ELIQSELSRESRRFLIKQGQN--SVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA 768
             +++     +R+ L+K   N  S + +++L G+   + I +  + ++  V  +  DY  
Sbjct: 720 SFLEN-TPLYARQVLVKNLGNGSSNMIDVSLEGLGCYLKIFNSDSSHVNKVKALQKDY-- 776

Query: 769 DPDTW 773
            P  W
Sbjct: 777 -PTEW 780
>hpy:HP0459 virB4; virB4 homolog; K03199 type IV secretion system protein VirB4
          Length = 858

 Score =  121 bits (303), Expect = 7e-26
 Identities = 141/694 (20%), Positives = 290/694 (41%), Gaps = 73/694 (10%)

Query: 124 TSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGI 183
           TS K ++   F +++T + K++    ++ I +++         L+ ++  LL+       
Sbjct: 179 TSSKKDKKNKFKKKITFSTKSKRALLIQTIERVKN-------ALKEFKPTLLNS------ 225

Query: 184 LFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWK 243
              E   F  + + G+          ++ +  +  V F K+   I  ++   F    G K
Sbjct: 226 --KEVLNFYAEYINGKYIAFNPKLKRLSDSYIASNVHFKKDYFVIEFQNQNTFCACVGIK 283

Query: 244 EYPSKTRPGMT-DGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDA 302
            Y S+    +    LL    E  L   F  +S      +   K  + +  +    + ID 
Sbjct: 284 AYESEEISSLPISTLLHTQIELDLI--FHIRSLGQFESLNFLKTKKKLTLSKIVKADIDN 341

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
             E +   ++NR  + E  L+L + A     L + L +  + L N G     E +GL+ +
Sbjct: 342 YIELV---QANRLSMQECALNLVIRAKSKAKLDKSLKEILSLLNNAGLGSVTETIGLKPS 398

Query: 363 WWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYF 421
           +++  P N +   R    TS+  A+L  F     G    N WG   +++ K    SPY F
Sbjct: 399 YFSFFPNNANINPRMRHQTSQVIASLILFEKNNTG-FRANSWGDMPLSVFKNLDHSPYLF 457

Query: 422 NFHYGD--------------LGNTFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQ 466
           NFH  +              +G+T + G +G+GKT ++++L+    K+ N  ++  D+  
Sbjct: 458 NFHNQEVKHKGVLAHNVARVVGHTMIIGATGAGKTTLISYLMMSALKYSNIDILALDRLN 517

Query: 467 GAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQER 526
           G   F +   G Y     G+   I P   +E +  N+ FL  +  ++   +     + + 
Sbjct: 518 GLYSFTKYFDGIY---NQGENFHINPF-SLEDSATNRAFLLHFYAQMAKVDSYDDHKDKV 573

Query: 527 QDIAKAINSLESL--------PHAQRSLGALQLFFD---------NTSKEGIAIRLQRWI 569
           +D    +N+++++          A+ S   L L FD          T+ + +    + ++
Sbjct: 574 EDRTALLNAIDTMYRNYNDEVKQAKFSNQELPLPFDLKEFVNAIAKTNTDILDSSFEDYL 633

Query: 570 KGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILD--LIDGRRII 627
           K +    +F +  D L+  ++    +    L N++    L  Y+F++++D  L   R  +
Sbjct: 634 KSS----LFSSRMDSLDFKTRISTINTDSILHNDDDAGLLAYYVFHKMIDRALKINRGFL 689

Query: 628 IVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQI 687
             IDEF    +++       + +   RK NG+++ A Q          A + I+     I
Sbjct: 690 CFIDEFKSYAQNEMMNKKINEIITQARKANGVIVLALQDINQLSEVRNAQSFIKNMGQLI 749

Query: 688 FFPNQKANYKDYVEDF--KLTEREFELIQSELSRESRRFL--IKQGQNSVVAELNLRGMN 743
            +P +  + KD  + F  +L++ E   +++    E +  L  +  G ++++ +++L  + 
Sbjct: 750 LYPQRNIDTKDLNDKFGIRLSDTEKHFLENTAVNEYKVLLKNMNDGSSNII-DVSLSSLG 808

Query: 744 DEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
           + + I S  +  +E ++ +I  Y   P TW  +F
Sbjct: 809 NYLQIFSSNSSMVEHIDNLIKHY---PKTWREVF 839
>hpy:HP0017 virB4; virB4 homolog; K03199 type IV secretion system protein VirB4
          Length = 787

 Score =  121 bits (303), Expect = 7e-26
 Identities = 163/783 (20%), Positives = 320/783 (40%), Gaps = 70/783 (8%)

Query: 21  NQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIAD--ERVALYSHIIR 78
           ++H +   +  L+ ++ +EGV++       L  L  +    L ++     R+ +    I 
Sbjct: 38  DEHFLLTKNENLVGILRLEGVSYTHLSTEQLQDLFTERQMALDSLEKVVARLVVKRRKID 97

Query: 79  RRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLASFFQRL 138
            ++ I  +S++  +     + K        E+Y N  F+ L         E   S    L
Sbjct: 98  HQQNIQSDSQYLQAILNQFENK--------EVYENQYFLVL---------ESTHSLHGVL 140

Query: 139 TKAKKTQSEPDMEAIRKIEELSQDLIQG-LESYEARLLSVYAHEGILFSEQSEFLHQLVG 197
              KK+    + E  + I       +Q  L+S E +L + YA + +   E   F  + + 
Sbjct: 141 EHKKKSLMHANRENFKDILSYKAHFLQETLKSLEIQLKN-YAPKLLSSKEVLNFYAEYIN 199

Query: 198 GRRERI-PLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKTRPGMTDG 256
           G    + PL  G ++ +  +  + F K+       + + +  + G K Y S+    +  G
Sbjct: 200 GFDLPLKPLVGGYLSDSYIASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIAIG 259

Query: 257 LLT---APFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDLESN 313
            L     P + I    F  +  +  + +   K+    + ++   +++    E +   ++ 
Sbjct: 260 ALLYQETPLDII----FSIEPMSVHKTLSFLKERAKFSMSNLVKNELLEYQELV---KTK 312

Query: 314 RFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSY 373
           R  + +  L++ + A   + L    S     L     V   E  GL+  +++  P     
Sbjct: 313 RLSMQKFALNILIKAPSLENLDAQTSLVLGLLFKENLVGVIETFGLKGGYFSFFPERIHL 372

Query: 374 RARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYFNFHYGDL---- 428
             R   +TS+  A L  F    +G  + N WG + +++ K    SP+ FNFH  ++    
Sbjct: 373 NHRLRFLTSKALACLMVFERQNLG-FKANSWGNSPLSVFKNLDYSPFLFNFHNQEVSHKN 431

Query: 429 --------GNTFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGGKY 479
                   G+T + G +GSGK+ +++FL+    K+ N  ++ FD+ QG   F +   G Y
Sbjct: 432 AKEIARVNGHTLIIGATGSGKSTLISFLMMSALKYQNMRLLAFDRMQGLYSFTKFFKGHY 491

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTE--QERQDIAKAINSL- 536
               +GQ   I P   +E   +N  FL+S+ L +         E  ++   I+ AI SL 
Sbjct: 492 H---DGQSFSINPFC-LEPNLQNLEFLQSFFLSMFDLAPSRDKEALEDMNAISSAIKSLY 547

Query: 537 ESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDM 596
           E+L     SL   +     TS   + + L+ ++       +F+   D  N ++     ++
Sbjct: 548 ETLYPKAFSLLDFKETLKRTSSNQLGLSLEPYLNNP----LFNALNDAFNSNAFLNVINL 603

Query: 597 TDFLDNEEIRRPLMMYLFNRILDLIDGRR----IIIVIDEFWKALEDDSFKAFAQDRLKT 652
                N +    L  YLF +IL+  + R+     ++ +DEF   +E+D         +  
Sbjct: 604 DTITQNPKDLGLLAYYLFYKILE--ESRKNDSGFLVFLDEFKSYVENDLLNTKINALITQ 661

Query: 653 IRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFEL 712
            RK NG+++ A Q          AH+ +    T I +P + A    +  +  L+E E   
Sbjct: 662 ARKANGVVVLALQDIYQLSGVKNAHSFLSNMGTLILYPQKNARELKHNFNVPLSETEISF 721

Query: 713 IQSELSRESRRFLIKQGQN--SVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADP 770
           +++     +R+ L+K   N  S + +++L  +   + I +  + ++  V  +  DY   P
Sbjct: 722 LEN-TPLYARQVLVKNLGNGSSNMIDVSLESLGRYLKIFNSDSSHVSKVKALQKDY---P 777

Query: 771 DTW 773
             W
Sbjct: 778 TEW 780
>wsu:WS1099 virB4 homolog; K03199 type IV secretion system protein VirB4
          Length = 762

 Score =  118 bits (296), Expect = 5e-25
 Identities = 146/679 (21%), Positives = 285/679 (41%), Gaps = 68/679 (10%)

Query: 125 SGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEAR----------L 174
           S K + + SF +   K +K  +E    ++ KIE+L +D  + LE Y  R          L
Sbjct: 127 STKNKGILSFLEE--KREKMTTEGGENSLYKIEQL-KDAAKMLELYLGRFRPRALDGEEL 183

Query: 175 LSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
           ++VYA     +   S  L     G           +  +     ++F ++ I    + +E
Sbjct: 184 MNVYAS----YCNMSPTLCSYKDGY----------LRDSYIDSNILFKRDYIIHERDGSE 229

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
            +      K Y ++    ++  +L+  F   ++ + +F+ ++ ++  +  K +Q I    
Sbjct: 230 IYSRYIAIKAYDTEE---ISSSILSTLFNIPVSMNVLFQIQSISKESVLWKVSQKIKMNS 286

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
           +    +  LD  L +L+S+R +L     ++ V A   + L +  ++ +A L   G +  R
Sbjct: 287 QNELVVAELDTLLKELQSDREMLLYFSFAVMVSAKTQEELNQRCNEVKAALVAKGLIAVR 346

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAA-VALLKT 413
           E L  +  +++  PG  +  +R+   +S   + +  F    I     N WG + V + K 
Sbjct: 347 ETLNQQPLYFSFFPGR-TINSRTRLQSSTAISTILTFEK-DIEGFSQNSWGESPVTIFKN 404

Query: 414 QAGSPYYFNFHYGD-----LGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGA 468
              +PY+FNFH         G+T V G + +GKT  ++FL+  L K    +   DK +G 
Sbjct: 405 ITETPYFFNFHMSPGKDCPNGHTLVIGNTYAGKTTFMSFLMTCLTKFEIDIFALDKLRGM 464

Query: 469 EIFVRAGGGKYKPLKNG---QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQE 525
             F    GG Y  + +     P  +AP      T +N +FL S++  L       + E+E
Sbjct: 465 HNFCTFLGGDYSDINDEFRLNPFSLAP------THENSLFLNSFLRLL-----GNIDERE 513

Query: 526 RQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDL 585
            +++    ++LE +     ++  L  +        +  R +  + G     +F +  D L
Sbjct: 514 YEEVNAIADTLERIYENSENITLLDFYESLERVPNLKHRYKSHLDG-----IFAHPDDAL 568

Query: 586 NLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRIL--DLIDGRRIIIVIDEFWKALEDDSFK 643
           +   Q    +M   L +E     L  Y+F++IL      G+   + +DE    L +D   
Sbjct: 569 SFQKQITILNMDSVLKDEIKASHLAYYVFHKILYQAKTKGKGAFVFVDELKDYLANDVMA 628

Query: 644 AFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDF 703
               + +  IRK NG++    Q+     N   A + I        FP    N +   +  
Sbjct: 629 HKLLETILEIRKLNGVVALGVQNLDFFDNIKNASSWINSMAHFAIFPT--TNTESIQKHI 686

Query: 704 KLTEREFELIQSELSRESRRFLIKQG--QNSVVAELNLRGMNDEIAILSGTTKNIELVNQ 761
           +LT  E   +++    E R+ L K    + SV+ ++NL  + + + + S + +++  +  
Sbjct: 687 ELTPAELRFLKNTNPLE-RKLLWKNANTKESVILDVNLSRLREYLRVFSSSAEDVLQMKA 745

Query: 762 IINDYGADPDTWLPIFHQR 780
           ++    A+ + W   + QR
Sbjct: 746 LL----AEGEGWREKYLQR 760
>psp:PSPPH_A0145 conjugal transfer protein
          Length = 651

 Score =  118 bits (295), Expect = 6e-25
 Identities = 132/611 (21%), Positives = 253/611 (41%), Gaps = 54/611 (8%)

Query: 10  PEEYIPYIRH-VNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE 68
           PE+ +P +R+ V++H++ L    L++++ ++GV+ +T     L  L + LN     +  +
Sbjct: 12  PEKKVPLMRYPVHEHMVTLPGNRLVSLIQLKGVSSETRSDEELIQLFHNLNRYFLALGKK 71

Query: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKT 128
                 H++ +         + +     LD +Y   + + + +  D + +   N T  + 
Sbjct: 72  EG---KHLMLQT--------YITKTGIELDTQYTLPLPALQDFV-DAYTAPFRNGTFFQV 119

Query: 129 EQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHE-GILFSE 187
               +        K  + +  +E +  +  LS  L   L  Y+  ++ +  +E G LFS+
Sbjct: 120 GYSIALI-----LKYREVDEGIERMSDLLSLSSTL---LAEYDPVIMGLEENEHGALFSQ 171

Query: 188 QSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK-EMIEIR-HESNERFVGMFGWKEY 245
              +   L+ G  + + ++   +   I      F   + +E R +   +RF   F  ++Y
Sbjct: 172 IGRYFSLLINGHEKDVLVSDTRLGDAIIDSVTNFENYDFVENRPNRGGQRFATTFDLRDY 231

Query: 246 PSK-TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALD 304
           PS  T PGM D  +   FEF L Q+F+F+ +  A+    +K    + + +R S Q + L+
Sbjct: 232 PSGGTYPGMWDEAIEQQFEFTLVQTFLFEDRNKAKDKF-KKHVADLGSVERDSKQTEELE 290

Query: 305 EALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWW 364
            A+D +       G +H SL V+ + P   +E  +K  +  T   A   R  +     W+
Sbjct: 291 NAVDAITLGDKAFGRYHASLIVYGNTPDQAIENGTKMASVFTVRDATFVRSTMSNIDTWY 350

Query: 365 AQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLK--TQAGSPYYFN 422
            Q PG  +        ++ N A     HS P GK++GN  G    ++   T   + Y  N
Sbjct: 351 TQFPG-VTEAMYPMMKSTENLACSFSLHSTPTGKVKGNPIGDGTGVMPVLTVNKALYVLN 409

Query: 423 FH--------YGDL--GNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFV 472
            H         G++  G+    G +G GKT     LL  L + +P +   D ++     +
Sbjct: 410 VHDSPPGQNNLGEMLPGHAVFTGQTGVGKTTAEATLLTFLSRFDPLIFSIDYNESLRHLL 469

Query: 473 RAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKA 532
            A G +Y  ++ G  TG+ P     +   +   LR  +  LV        +    D  + 
Sbjct: 470 CALGAEYYTVQLGHFTGVNP-----FQFHDSPGLRQMLFDLVLCCAGGPDKSNDADQTRI 524

Query: 533 INSLES-LPHAQRSLGALQLFFDNTSKEG---IAIRLQRWI------KGNDLGWVFDNDQ 582
            +S+E+ + H      ++ L   N  ++G   +  RL +W       +     WV D+  
Sbjct: 525 KDSIEAVMAHTNVRNRSMSLLLRNIPEQGENCLRTRLSKWCRLAGEGRVGQYAWVLDSPV 584

Query: 583 DDLNLDSQFIG 593
           +  +  +   G
Sbjct: 585 NQFDAQTYLAG 595
>hpy:HP0441 VirB4 homolog; K03199 type IV secretion system protein VirB4
          Length = 807

 Score =  115 bits (287), Expect = 5e-24
 Identities = 166/796 (20%), Positives = 321/796 (40%), Gaps = 95/796 (11%)

Query: 3   IMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLL 62
           + KR ++ EE    +   N+H +      L+  + +EG+++ + D   +    N+    L
Sbjct: 13  VPKRYNMKEE-TNIVGIYNEHYLLSEKSNLVGALKLEGISYLSLDDKEIAQKFNERILAL 71

Query: 63  RNIADERVALYSHIIRRRETI----YPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVS 118
             I D     +  +++RR+      Y +    + FA  +   +++ +  +++Y+N  F  
Sbjct: 72  NEIVDG--VHFKIVVKRRKIFMHHEYTQEEISNPFALEVINLWEQGV--EDVYQN--FYY 125

Query: 119 LLWNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELS--QDLIQGLESYEA---- 172
           L++     K + +  + +R  K   T    +++   + +E+   ++   G +++      
Sbjct: 126 LIFET---KNDSIKGYLERFKKKITTNELENIQENNRQDEVKYQENYFIGFDNFNLLDKS 182

Query: 173 -----------RLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIF 221
                       +LS    E I  +    F  + + G         G +   + +  V F
Sbjct: 183 KILYSIINNVKNMLSGLFVEKIDANSLLNFYAEYINGVPSEYTFARGRLHDGMINSDVHF 242

Query: 222 GKEMIEIRHESNERFVGMFGWKEYPSK--TRPGMTDGL-LTAPFEFILTQSFVFKSKAAA 278
            K+     H   E F      K Y         ++  L L+  F+ IL    + K+KA  
Sbjct: 243 KKDFFTHIHNGKEIFKRFISIKTYDIDKIVSTALSSVLHLSLEFDVILNIDNIPKAKAEK 302

Query: 279 RVIMGRKQNQMINAADRASSQIDA-LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEY 337
           R+   RK         RA+  I   +DE  D ++++R ++ E  L++ V A     L   
Sbjct: 303 RIETKRK---------RANKSIRVEIDELNDMIKTDRVLMQEISLNILVHAKTKTDLDSA 353

Query: 338 LSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIG 397
             +    L   G V  +E +G+   +++  P       R   ++S+N A+L        G
Sbjct: 354 CIEITNLLKQKGIVSTQESIGMLPMFFSFFPNRNRLNFRKRLLSSQNIASLIILEKQNCG 413

Query: 398 KLEGNVWGAA-VALLKTQAGSPYYFNFHYGDL--------GNTFVCGPSGSGKTVIVNFL 448
               N WG   + + + Q  SPY FNFH  +         G+T + G +G+GKT ++ FL
Sbjct: 414 -FSRNSWGDRHLTIFRNQDKSPYLFNFHAYEAKRKNDMVSGHTIIFGGTGAGKTTLIEFL 472

Query: 449 LAQLQKHNPTMVF-FDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLR 507
           +    K+    +   D++ G  +      G+Y    +     I P   ++ T  N  FL 
Sbjct: 473 ITNCFKYEDLSILALDRNNGMRVMTEFLDGQYN---DSNDFYINPFS-LKDTSANCTFLV 528

Query: 508 SWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQR 567
           SW+  ++  +  T  E+E+    K +++L            +++ ++N +K+G AI   R
Sbjct: 529 SWLAFMLNIDEDTKDEKEK----KTLSALSK---------TIRVCYNNITKQGGAIFKLR 575

Query: 568 WIKGN-DLGWVFDND--------------QDDLNLDSQFIGYDMTDFLDNEEIRRPLMMY 612
             K   ++ ++   D               D L+   +    DM     +++     ++Y
Sbjct: 576 DFKDTLEIDYLDSKDILEKESSKDLYKHSTDCLDFAKKLSVIDMDALSSSKKDFNLAVLY 635

Query: 613 LFNRILDL--IDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDA 670
           LF ++++   ++ +   I IDE    +E+    A  +D L   RK NG++  A Q     
Sbjct: 636 LFYKVMNRAKLENKPFYIFIDEAKSVIENPIMLAKIKDTLAQARKLNGVLTLAFQDINQL 695

Query: 671 LNSTIAHTIIEQCPTQIFFP-NQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQ- 728
                A +IIE     I +P N     + Y       E+ F    ++    +R+ L+K  
Sbjct: 696 DGVEGAKSIIENAAQVILYPTNNFEKLESYGILLSPIEKSF---LNKTPLNARQVLVKNL 752

Query: 729 -GQNSVVAELNLRGMN 743
             Q+SV  E+NL  +N
Sbjct: 753 LTQSSVFLEINLEKLN 768
>hac:Hac_1691 virB4; type IV secretory pathway component VirB4
          Length = 787

 Score =  112 bits (279), Expect = 5e-23
 Identities = 167/782 (21%), Positives = 318/782 (40%), Gaps = 68/782 (8%)

Query: 21  NQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRR 80
           ++H +   +  L+ V+ +EGV++    +  L  L       L ++  E+V     + RR+
Sbjct: 38  DEHFLLTKNENLVGVLRLEGVSYTHLSVEQLQDLFTDRQMALDSL--EKVVARIVVKRRK 95

Query: 81  ETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLASFFQRLTK 140
                  +  S     +  +++ K    E+Y N  F+ L         E   S    L  
Sbjct: 96  IDYQQNIQANSQHLQAILNQFENK----EVYENQYFLVL---------ESTHSLQGVLEH 142

Query: 141 AKKTQSEPDMEAIRKIEELSQDLIQG-LESYEARLLSVYAHEGILFSEQSEFLHQLVGGR 199
            KK+    + E  + I       +Q  L S E +L + YA + +   E   F  + + G 
Sbjct: 143 KKKSLMHANRENFKDILSYKVHFLQETLRSLEIQLKN-YAPKLLNSKEVLNFYAEYINGF 201

Query: 200 RERI-PLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVG-MFGWKEYPSKTRPGMTDGL 257
              + PL  G ++ +  +  V F K+   I+   N++    + G K Y S+    +  G 
Sbjct: 202 ELPLKPLVGGYLSDSYIASSVTFEKDYF-IQESFNQKIYNRLIGIKAYESERITSIAIGA 260

Query: 258 LT---APFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDDLESNR 314
           L     P + I    F  +  +  + +   K+    + +    +++    E +   ++ R
Sbjct: 261 LLYQETPLDII----FSIEPMSVHKTLSFLKERAKFSMSGLVKNELLEYQELV---KTKR 313

Query: 315 FVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYR 374
             + +  L++ + A     L    S     L     V   E  GL+  +++  P      
Sbjct: 314 LSMQKFALNILIKAPSLGRLDAQTSLILGLLFKENLVGVIETFGLKGGYFSFFPECIHLN 373

Query: 375 ARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYFNFHYGDLGN--- 430
            R   +TS+  A L  F    +G  + N WG + +++ K    SP+ FNFH  ++G+   
Sbjct: 374 HRLRFLTSKALACLMVFERQNLG-FKANSWGNSPLSVFKNLDYSPFLFNFHNQEVGHKNA 432

Query: 431 ---------TFVCGPSGSGKTVIVNFLLAQLQKH-NPTMVFFDKDQGAEIFVRAGGGKYK 480
                    T + G +GSGK+ +++FL+    K+ N  ++ FD+ QG   F     G Y 
Sbjct: 433 KEIPRVNGHTLIIGATGSGKSTLMSFLMMSALKYQNMRLLAFDRMQGLYSFTEFFKGYYH 492

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKL--VTTEGQTVTEQERQDIAKAINSL-E 537
              +G+   I P   +E   +N  FL+S+ L +  +T        ++   I+ AI SL E
Sbjct: 493 ---DGKSFSINPFC-LEPNLQNLEFLQSFFLSMFDLTPSRNKEALEDMNAISSAIKSLYE 548

Query: 538 SLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMT 597
           +L     SL   +     TS   + + L+ ++       +F+   D  N ++     ++ 
Sbjct: 549 TLYPKAFSLLDFKETLKRTSSNQLGLSLEPYLNNP----LFNALNDAFNSNAFLNVINLD 604

Query: 598 DFLDNEEIRRPLMMYLFNRILDLIDGRR----IIIVIDEFWKALEDDSFKAFAQDRLKTI 653
               N +    L  YLF +IL+  + R+     ++ +DEF   +E+D         +   
Sbjct: 605 TITQNPKDLGLLAYYLFYKILE--ESRKNDSGFLVFLDEFKSYVENDLLNTKINALITQA 662

Query: 654 RKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELI 713
           RK NG+++ A Q          AH+ +    T I +P + A       +  L+E E   +
Sbjct: 663 RKANGVVVLALQDIYQLSGVKNAHSFLSNMGTLILYPQKNARELKNHFNVPLSETEISFL 722

Query: 714 QSELSRESRRFLIKQGQN--SVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPD 771
           ++     +R+ L+K   N  S + +++L  +   + I +  + ++  V  +  DY   P 
Sbjct: 723 EN-TPLYARQVLVKNLGNGSSNMIDVSLESLGRYLKIFNSDSSHVNKVKALQKDY---PK 778

Query: 772 TW 773
            W
Sbjct: 779 EW 780
>nwi:Nwi_2098 trbE; conjugal transfer protein TrbE; K03199 type IV secretion
           system protein VirB4
          Length = 401

 Score = 98.2 bits (243), Expect = 7e-19
 Identities = 98/380 (25%), Positives = 176/380 (46%), Gaps = 35/380 (9%)

Query: 265 ILTQSFVFKSKAAA--RVIMGRKQNQMINAADRASSQIDALDEALDDLESNRFVLGEHHL 322
           I  Q F  +   AA  + +M  +Q+ +++  D A+   DA D AL DL S++  +GE ++
Sbjct: 14  IRRQWFAKRKSVAAILKEVMTNEQSVLLDT-DAANKAADA-DAALQDLGSDQ--VGEVYV 69

Query: 323 SLAVF--------ADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYR 374
           +  V         AD+   LVE + ++R        V A E      AW   +PG     
Sbjct: 70  TATVMVWSADRTIADERLRLVEKVIQSRDFTCIVEGVNAIE------AWLGSIPGQTYAN 123

Query: 375 ARSGAITSRNFAALSPFHSFPIGKLEGNVWGAA-VALLKTQAGSPYYFNFHYGDLGNTFV 433
            R   I++ N A + P  +   G       GA  +   KT+  +P+ F  H GD+G+T +
Sbjct: 124 VRQPPISTLNLAHMMPLSAVWAGPARDEHLGAPPLFYAKTEGATPFRFALHVGDVGHTMI 183

Query: 434 CGPSGSGKTVIVNFLLAQLQKHNPTMVF-FDKDQGAEIFVRAGGGKYKPL-----KNGQP 487
            GP+G+GK+V++  +  Q +++  + VF FD          A GG ++ L      + + 
Sbjct: 184 VGPTGAGKSVLLALMALQFRRYRNSQVFVFDFGGSIRAATLAMGGDWQDLGGTLTDDAES 243

Query: 488 TGIA--PLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRS 545
           T ++  PL  + +    + +   W++ ++  EG TVT   ++ I  A+ SL S P  +R+
Sbjct: 244 TSVSLQPLAFIHHV-LERAWAADWLVDILLREGVTVTPDVKEYIWAALTSLASAPVEERT 302

Query: 546 LGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEI 605
           +  L +   +++   +   L+ +  G   G + D + + L   +  +    T+ L   + 
Sbjct: 303 ITGLTVLLQSSA---LKQALRPYCIGGAHGRLLDAEHEYLGTAN--VQAFETEGLVGTKA 357

Query: 606 RRPLMMYLFNRILDLIDGRR 625
              ++ YLF+RI    DGRR
Sbjct: 358 APAVLSYLFHRIEARFDGRR 377
>nse:NSE_0766 virB4-1; type IV secretion system protein VirB4
          Length = 750

 Score = 92.4 bits (228), Expect = 4e-17
 Identities = 155/759 (20%), Positives = 302/759 (39%), Gaps = 58/759 (7%)

Query: 32  LMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRR-ETIYPESRFF 90
           L+ V+ +    F T+ +  + SL  ++   L +     + L+ +++R    ++  E+   
Sbjct: 32  LVRVVKLSDFRFTTSSLERMRSLCKKV---LYSGEFRCLGLWINVVRSPIGSVRAENVSM 88

Query: 91  SSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLASFFQRLTKAKKTQSEPDM 150
             FAA L + Y K +  +  + N++F+S++             F  R +  K+       
Sbjct: 89  DGFAAGLSDTYHKFVEKENRFSNEVFISIVSESALECAVGQVDFLLR-SLLKRFDEFASK 147

Query: 151 EAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQLVGGRRERIPLTFGTI 210
             ++ +E+    +   L  Y+  LL          +E   FL  L+G  +  +      I
Sbjct: 148 VIVKSLEDAVAVVCTELAEYQPVLLCE--------AEVMNFLSALLGISKTGLESGVRDI 199

Query: 211 ASTIYSDR-VIFGKEMIEIRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQS 269
           ++ + SDR V FG    EI H     F   F  K + +          L A    ++T+ 
Sbjct: 200 STELLSDRKVFFGFNTFEI-HGDKRTFGTSFSVKSFRNLEDVQFVARFLGAQNRMVITEV 258

Query: 270 FVFKSKAAARVIMGRK---QNQMINAADRASSQIDALDEALDDLESNRFVLGEHHLSLAV 326
               ++   R            + + A +++S  D + E +++     F   +    + +
Sbjct: 259 ITRTTEEDIRDTFEESLELTGVVNDTAYQSASSKDIIAEHINEKRKEEFC--KRSFKVTL 316

Query: 327 FADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFA 386
           FAD  + L   ++      ++ G +I R+DL LE  +W  LPGNFS   +   +  +  +
Sbjct: 317 FADSLEELGLVVANCEKLFSHRGFMIVRDDLLLEDTFWGNLPGNFSRMRKWEIVLLKEIS 376

Query: 387 ALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF-HYGDLGNTFVCGPSGSGKTVIV 445
           + +  H+     L  +V    +    +  G  +YF+F       +  + G   S +  + 
Sbjct: 377 SFAFTHAH-FRSLLADV-NKCLTKFVSLEGELHYFSFPDAKSKSHAIIFGKEKSSRIELQ 434

Query: 446 NFLLAQ-LQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKI 504
           NFLL + + +     +  D    +E+FV A  G Y  + +G       L  +   +    
Sbjct: 435 NFLLLESVVRLGAEFLIVDDQSLSEVFVHALEGSYIEVSDG--AFRCNLLDVADVDVLYD 492

Query: 505 FLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLG----ALQLFFDNTSKEG 560
            L S+  K V +E          +IA     +  +P  +RSL      LQ  F   S   
Sbjct: 493 ILSSFCSKDVKSE----------EIAGVAKKISEIPLGKRSLTDCAVHLQPIFGELS--- 539

Query: 561 IAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDL 620
                   I     G +F +D ++  L    +G+ +      E++   +  Y+  R +++
Sbjct: 540 --------ILQKSYGHLFTSDAENGWLLEDKLGFSVDKLSLPEKVISSVTSYVIARYIEV 591

Query: 621 --IDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHT 678
               G+  IIVI    +     S  +  +  L  + +  GM+LF++++   A    +   
Sbjct: 592 RKKSGKPFIIVIQSPTRFKRLFSSLSKCESFLCEVSECGGMILFSSEN--TAFLEKLGEV 649

Query: 679 IIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELN 738
             +   T++F P       +Y + F  +      +  + S   + F + QG NSV+ + +
Sbjct: 650 GTKYITTRMFLPLSDTLPVEYNKFFTSSASVMRTL-DDASLFGKCFFLNQGGNSVILKFD 708

Query: 739 LRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIF 777
              + +E+ ILS   + IE +   + + G +P  WLPIF
Sbjct: 709 SL-LFEEMKILSSCGR-IEKMRAAMREAGNNPAIWLPIF 745
>hpj:jhp0917 virB4_2; DNA transfer protein; K03199 type IV secretion system
           protein VirB4
          Length = 475

 Score = 80.1 bits (196), Expect = 2e-13
 Identities = 79/321 (24%), Positives = 146/321 (45%), Gaps = 18/321 (5%)

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
           + ++R  + +  LS+ VFA+  K L +        L   G     E + +   +++  P 
Sbjct: 135 VSTDRAQIQKVSLSIMVFANSKKELDKKSIIVYNTLKKEGFSAVLESINMRPIFFSFFPE 194

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG-AAVALLKTQAGSPYYFNFHYGD- 427
                +R    TS+N A+L  F  +  G  E N WG   V++ K Q GS ++FNF     
Sbjct: 195 RNFLNSRLRPQTSQNIASLIMFEKYQEGFKE-NSWGDCPVSVFKNQNGSAHFFNFQAKQG 253

Query: 428 -------LGNTFVCGPSGSGKTVIVNFLLAQ-LQKHNPTMVFFDKDQGAEIFVRAGGGKY 479
                  +G+T + G +GSGK+  ++FL+A  L K++ ++V  D+  G EI      G+Y
Sbjct: 254 KDKNDNVVGHTMIIGSTGSGKSTFISFLIANLLTKYDMSVVALDRMNGLEIMTDFFEGQY 313

Query: 480 KPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQE-RQDIAKAINSLES 538
                     I P   ++ +E+N+ FL +W+  ++  +     + +  Q I K I    +
Sbjct: 314 NTANTDGGFYINPF-SLKDSEENRQFLANWIKFMLNIDSDNQQDNKASQSIDKVIRDTYN 372

Query: 539 LPHAQRS-LGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNL-DSQFIGYDM 596
               Q++ +  L++  +  S E         +K       F N QD L+  +S     +M
Sbjct: 373 YMGDQKNQINLLEIAKNLGSSEQ---DFNEILKSQGEKIYFKNFQDCLDFSNSPLSVINM 429

Query: 597 TDFLDNEEIRRPLMMYLFNRI 617
             F +++++   + MYLF+++
Sbjct: 430 DAFANDKKLMGLIAMYLFHKL 450
>nar:Saro_2162 ATPase
          Length = 847

 Score = 79.3 bits (194), Expect = 3e-13
 Identities = 74/332 (22%), Positives = 143/332 (43%), Gaps = 24/332 (7%)

Query: 396 IGKLEGNVWGAAVA--LLKTQAGSPYYFNFHYGDLGN--TFVCGPSGSGKTVIVNFLLAQ 451
           I  ++G   G+A    L   + G P++++    + GN    +CG SGSGK+V++  + A 
Sbjct: 442 IAPMQGEYLGSAHPHLLFIGRRGQPFFWSPFENEAGNHNVAICGKSGSGKSVLLQEMCAA 501

Query: 452 LQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNK-------- 503
           L+     +V  D  +  E  V+  GG++          + P   ++ T   +        
Sbjct: 502 LRGAGAQVVVIDDGRSFEHSVKLQGGRFVEFTIAAGFCLNPFSMIDATRATEDEDYRLDC 561

Query: 504 IFLRSWVLKLVTTEGQTVTEQERQDIAKAINSL---ESLPHAQRSLGALQLFFDNTSKEG 560
             +   ++  +      +T+ ER  I +A+N +           ++G +     + +   
Sbjct: 562 FGMIKAIVGQMARHSAKLTDTERGLIDRAVNLVWAQHGTAATVTTVGEMLASLGHDTAAD 621

Query: 561 IAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLM---MYLFNRI 617
           IA  L  ++ G   G  F+  Q  L+LD+ F  ++M+D    E++R  ++   M++ ++ 
Sbjct: 622 IATALAPYMAGGTYGAFFEG-QASLDLDADFTVFEMSDLASREDLRSVVLSAIMFMTSQA 680

Query: 618 LDLID-GRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIA 676
           +       R +++IDE W  L+  S   F +   +T RK  G +  ATQS  D   S  A
Sbjct: 681 MTRSPRSLRKLLLIDEAWSMLKGGSMGEFVETYARTCRKYGGALATATQSLNDYYKSDGA 740

Query: 677 HTIIEQCPTQIFFPNQKANYKDYVEDFKLTER 708
              +E     +    +     + + DFK ++R
Sbjct: 741 TAALENSDWMLILQQK----PETIADFKASKR 768
>bth:BT4770 conserved protein found in conjugate transposon
          Length = 772

 Score = 79.0 bits (193), Expect = 4e-13
 Identities = 101/473 (21%), Positives = 188/473 (39%), Gaps = 67/473 (14%)

Query: 297 SSQIDA--LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
           S+QI+   LDE L++  SN       H ++  +A+    L    +   + L         
Sbjct: 238 SNQINKEWLDEYLNEAHSNGLQSVRCHCNIVAWAENGDELRRVKNDVGSALALMECTPHH 297

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKL---------EGNVWG 405
               L A +WA +PGN             +F A   F++F    L           ++  
Sbjct: 298 NTTDLPALYWAGIPGN-----------EADFPAEETFYTFTGQALCFFTAETCYRNSLSP 346

Query: 406 AAVALLKTQAGSPYYFNFHYGDL---------GNTFVCGPSGSGKTVIVNFLLAQLQKHN 456
             + ++    G P + +    DL          N F+ GPSGSGK+   N L+ Q  +  
Sbjct: 347 FGIRMVDRLTGKPVFLDI--SDLPMKKGVVTNRNKFILGPSGSGKSFFTNHLVRQYWEQG 404

Query: 457 PTMVFFDKDQGAE-----IFVRAGG--GKYKPLKNGQPTGIAPL--KGMEYTEKNKIFLR 507
             ++  D     +     I  + GG  G Y   K   P    P   +  +Y  + +  ++
Sbjct: 405 THILLVDTGNSYKGLCDLIHQKTGGDDGIYFTYKENDPISFNPFFTEDYQYDIEKRDSIK 464

Query: 508 SWVLKLVTTEGQTVTEQERQDIAKAIN-SLESLPHAQRSLGALQLFFDNTSK-------- 558
           + +L L   E +     E   ++ A++  +E +   ++       F+D   K        
Sbjct: 465 TLILTLWKREDEPPRRSEEVALSNAVSLYIEKIKKNRKIKPNFNSFYDFVRKDYRKVLAD 524

Query: 559 ----------EGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE---EI 605
                     +G    L+ + K  + G++ ++D++   L+ +FI +++    DN     +
Sbjct: 525 KNVREKDFDVDGFLNVLEPYYKNGEYGYLLNSDKELDLLNKRFIVFELDVVKDNPILFPV 584

Query: 606 RRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQ 665
              ++M  F   +  + G R +I+I+E WKA+  +    + +   KT+RK  G  +  TQ
Sbjct: 585 VTIIIMETFINKMRRLQGIRKMILIEEAWKAIAKEGMANYIRYLFKTVRKFYGEAVVVTQ 644

Query: 666 SPKDALNS-TIAHTIIEQCPTQIFFPNQKANYK-DYVED-FKLTEREFELIQS 715
              D ++S  +  TII     +I    +K   K D +++   LT++E   I S
Sbjct: 645 EVDDIISSPVVKETIINNSDCKILLDQRKYQNKFDQIQNLLGLTDKERSQILS 697
>bfr:BF0123 TraG
          Length = 834

 Score = 77.4 bits (189), Expect = 1e-12
 Identities = 111/537 (20%), Positives = 215/537 (40%), Gaps = 65/537 (12%)

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           +D+ L++  S        H ++  ++D  + L    +   + L +   V     +     
Sbjct: 307 IDQYLNEAHSYGLTSVRAHFNVMAWSDDAEELKHIKNDVGSQLASMECVPRHNTIDCPTL 366

Query: 363 WWAQLPGN------------FSYRARSGAITSRNF-AALSPFHSFPIGKLEGNVWGAAVA 409
           +WA +PGN            F  +A        N+ ++LSPF    + +L G      ++
Sbjct: 367 YWAAIPGNAADFPAEESFHTFIEQAVCLFTEETNYRSSLSPFGIKMVDRLTGKPLHLDIS 426

Query: 410 LLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAE 469
            L  + G             N FV GPSGSGK+  +N L+ Q  +    +V  D     +
Sbjct: 427 DLPMKRGITTN--------RNKFVLGPSGSGKSFFMNHLVRQYYEQGAHVVLVDTGNSYQ 478

Query: 470 -----IFVRAGG--GKYKPLKNGQPTGIAPLKGMEYT--EKNKIFLRSWVLKLVTTEGQT 520
                I  + GG  G Y      +P    P    +Y    + K  +++ +L L  +E   
Sbjct: 479 GLCGMIRRKTGGADGVYFTYTEDKPISFNPFYTDDYIFDVEKKDSIKTLLLTLWKSEDDK 538

Query: 521 VTEQERQDIAKAINSLESLPHAQRSL-GALQLFF----DNTSKE---------------- 559
           VT+ E  ++  A+++      + RS+  +   F+    D+  KE                
Sbjct: 539 VTKTESGELGSAVSAYIERIQSDRSIVPSFNTFYEYMRDDYRKELAQRDIKVEKSDFNID 598

Query: 560 GIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEE---IRRPLMMYLFNR 616
            +   ++++ +G    ++ ++ ++   L  +FI +++    +N E   +   ++M  F  
Sbjct: 599 NMLTTMRQYYRGGRYDFLLNSTENIDLLGKRFIVFEIDSIKENRELFPVVTIIIMEAFIN 658

Query: 617 ILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNS-TI 675
            +  + G R  ++++E WKAL   +   + +   KT+RK  G  +  TQ   D ++S  +
Sbjct: 659 KMRRLKGVRKQLIVEEAWKALSSANMAEYLRYMYKTVRKYYGEAIVVTQEVDDIISSPVV 718

Query: 676 AHTIIEQCPTQIFFPNQK-ANYKDYVED-FKLTEREFELIQSELSRESRRFLIKQ----- 728
             +II     +I    +K  N  D ++    LTE+E   I S     +   L K+     
Sbjct: 719 KESIINNSDCKILLDQRKYMNKFDQIQALLGLTEKEKSQILSINMANNPSRLYKEVWIGL 778

Query: 729 -GQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQRRENQ 784
            G  S V    +    + +A  +  T+ +E V ++    G D +  +    +RR N+
Sbjct: 779 GGTQSAVYATEV-SAEEYLAYTTEETEKVE-VYRLAEKLGDDIEAAIRQLAERRRNK 833
>bfs:BF1767 traG; putative conserved protein found in conjugate transposon
          Length = 833

 Score = 72.8 bits (177), Expect = 3e-11
 Identities = 102/470 (21%), Positives = 191/470 (40%), Gaps = 59/470 (12%)

Query: 297 SSQIDA--LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
           S+QI+   ++E L++  S        H ++  ++D  + L    ++  + L         
Sbjct: 300 SNQINKAWIEEYLNEAHSKGLTSVRCHCNVMAWSDDREELRRIKNEVGSQLALMECKPRH 359

Query: 355 EDLGLEAAWWAQLPGN------------FSYRARSGAITSRNFA-ALSPFHSFPIGKLEG 401
             + +   +WA +PGN            F  +A        N+  +LSPF      ++ G
Sbjct: 360 NTVDVPTLFWAAIPGNEGDFPFEESFYTFIPQALCFFTEETNYKDSLSPFGIKMADRMTG 419

Query: 402 NVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVF 461
                 ++ L  + G             N FV GPSGSGK+  +N L+ Q  + N  +V 
Sbjct: 420 RPLHLDISDLPMKKGVI--------SNRNKFVLGPSGSGKSFFMNHLVRQYYEQNSHIVL 471

Query: 462 FDKDQG----AEIFVRAGGGK---YKPLKNGQPTGIAPLKGMEY--TEKNKIFLRSWVLK 512
            D         E+  R   G+   Y      +P    P    +Y  + + K  +++ +L 
Sbjct: 472 IDTGNSYQGLCELIHRKTKGEDGIYYTYTEEKPISFNPFFTDDYKFSVEKKDSIKTLLLA 531

Query: 513 LVTTEGQTVTEQERQDIAKAINSLESLPHAQRSLG-ALQLFFD---NTSKEGIAIR---- 564
           L   E + VT+ E  ++  A+++        R +  +   F++   N  ++ +A R    
Sbjct: 532 LWKGEDEKVTKTESGELGSAVSAYIRRIQQNRDIAPSFDTFYEYMLNDYRKELAARDIKV 591

Query: 565 -------------LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEE---IRRP 608
                        L+++ KG    ++ +++++   L  +FI +++    DN E   +   
Sbjct: 592 SREDFNIDNFLTTLRQYYKGGRYDFLLNSNENIDLLHKRFIVFEIDAVKDNAELFPVVTI 651

Query: 609 LMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPK 668
           ++M  F   L  + G R +++ +E WKAL   S   + +   KT+RK  G  +  TQ   
Sbjct: 652 IIMEAFINKLRRLKGVRKMLICEEAWKALSSPSMSEYLKYLYKTVRKYFGEAIVVTQEVD 711

Query: 669 DALNSTIA-HTIIEQCPTQIFFPNQK-ANYKDYVED-FKLTEREFELIQS 715
           D ++S I    II     +I    +K  N  D ++    LT++E   I S
Sbjct: 712 DIISSPIVKEAIITNSDCKILLDQKKYMNKFDGIQSMLGLTDKEKSQILS 761
>bfr:BF1358 conserved protein found in conjugate transposon
          Length = 837

 Score = 65.5 bits (158), Expect = 5e-09
 Identities = 96/461 (20%), Positives = 184/461 (39%), Gaps = 57/461 (12%)

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           +DE L++  S   +    H ++  ++D    L    +   + L           +     
Sbjct: 308 IDEYLNEAHSKGLISVRCHCNVMAWSDDRDELKRIRNDVGSQLALMECKPRHNTVDTPTL 367

Query: 363 WWAQLPGN------------FSYRARSGAITSRNF-AALSPFHSFPIGKLEGNVWGAAVA 409
           +WA +PGN            F  +A    +   N+ ++LSPF    + ++ G      ++
Sbjct: 368 FWAGIPGNEADFPAEESFYTFLGQALCLFVEETNYKSSLSPFGIKMVDRVSGRPLHIDIS 427

Query: 410 LLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQG-- 467
            L  + G             N F+ GPSGSGK+   N ++ Q  +    ++  D      
Sbjct: 428 DLPMKKGITTN--------RNKFILGPSGSGKSFFTNHMVRQYYEQGAHVLLVDTGNSYL 479

Query: 468 ---AEIFVRAGG--GKYKPLKNGQPTGIAPL---KGMEYTEKNKIFLRSWVLKLVTTEGQ 519
                I  R  G  G Y    N  P    P     G+   EK K  +++ +L L   + +
Sbjct: 480 GLSQLIHNRTHGEDGIYFTYTNENPIAFNPFYVEDGVFDIEK-KESIKTLILTLWKRDDE 538

Query: 520 TVTEQERQDIAKAINSLESLPHAQRSLGAL--------------QLFFDNTSKEGIAIR- 564
                E   ++ A+++   L    RS+                 QL   N  ++   I  
Sbjct: 539 APKRSEEVALSNAVSAYIELIGKDRSVTPCFNTFYEFVRDDYRRQLEQKNVREKDFDIDN 598

Query: 565 ----LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE---EIRRPLMMYLFNRI 617
               L+ + +G +  ++ ++D++   L  +FI +++ +  D++    +   ++M  F   
Sbjct: 599 FLNVLEPYYRGGEYDYLLNSDKELDLLHKRFIVFELDNIKDHKILFPVTTIIIMEAFINK 658

Query: 618 LDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIA- 676
           +  + G R +I+I+E WKA+   +   + +   KT+RK  G  +  TQ  +D ++S I  
Sbjct: 659 MRKLKGIRKLILIEEAWKAIASANMADYIRYLYKTVRKYFGEAIVVTQEIEDIISSPIVK 718

Query: 677 HTIIEQCPTQIFFPNQK-ANYKDYVED-FKLTEREFELIQS 715
            +II     +I    +K  N  D +++   LT++E   I S
Sbjct: 719 ESIINNSDCKILLDQRKYLNKFDSIQNLLGLTDKERSQILS 759
>pgi:PG1481 conjugative transposon protein TraG
          Length = 841

 Score = 64.7 bits (156), Expect = 8e-09
 Identities = 70/323 (21%), Positives = 141/323 (43%), Gaps = 38/323 (11%)

Query: 430 NTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIF-------VRAGGGKYKPL 482
           N FV GPSGSGK+  +N L+ Q  +    ++  D     +          +   G Y   
Sbjct: 440 NKFVLGPSGSGKSFFMNHLVRQYYEQGTHVLLVDTGNSYQGLCSLIHRKTKGEDGIYFTY 499

Query: 483 KNGQPTGIAPL---KGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESL 539
              +P    P     G+   EK K  +++ +L L  +E + +++ E  ++  A+++   L
Sbjct: 500 TEEEPISFNPFYTDDGVFDVEK-KDSIKTLLLTLWKSEEEKISKTESGELGSAVSAYIRL 558

Query: 540 PHAQRSLG-ALQLFFD---------------NTSKEGIAI-----RLQRWIKGNDLGWVF 578
             + R +  +   F++                 S+E   I      L+++ +G    ++ 
Sbjct: 559 IGSDRGITPSFNTFYEFMRDTYRPELENREIKVSREDFNIDNFLTTLRQYYRGGRFDFLL 618

Query: 579 DNDQDDLNLDSQFIGYDMTDFLDNEE---IRRPLMMYLFNRILDLIDGRRIIIVIDEFWK 635
           ++D++   L  +FI +++    +N E   +   ++M  F   +  + G R  ++++E WK
Sbjct: 619 NSDKNIDLLSKRFIVFEIDAIKENRELFPVVTIIIMEAFINKMRRLKGVRKQLIVEEAWK 678

Query: 636 ALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNS-TIAHTIIEQCPTQIFFPNQK- 693
           A+   +   + +   KT+RK  G  +  TQ   D ++S  +  +II     +I    +K 
Sbjct: 679 AIASANMADYLKYMYKTVRKYFGEAIVVTQEVDDIISSPVVKESIINNSDCKILLDQRKY 738

Query: 694 ANYKDYVED-FKLTEREFELIQS 715
           AN  D +++   LT++E   I S
Sbjct: 739 ANKFDQIQNLLGLTDKEKSQILS 761
>bth:BT0093 conserved protein found in conjugate transposon
          Length = 834

 Score = 64.7 bits (156), Expect = 8e-09
 Identities = 90/454 (19%), Positives = 183/454 (40%), Gaps = 55/454 (12%)

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           ++E L++  S   +    H ++  ++D    L    +   + L                 
Sbjct: 308 IEEYLNEAHSQGLISVRCHCNIMAWSDDRDELKHIKNDVGSQLALMECKPRHNTTDTPTL 367

Query: 363 WWAQLPGN------------FSYRARSGAITSRNF-AALSPFHSFPIGKLEGNVWGAAVA 409
           +WA +PGN            F  +A        N+ ++LSPF    + ++ G      ++
Sbjct: 368 FWAGIPGNQADFPAEESFYTFIEQALCLFTEETNYKSSLSPFGIKMVDRVTGKPLHIDIS 427

Query: 410 LLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQG-- 467
            L  + G             N F+ GPSGSGK+   N ++ Q  + N  ++  D      
Sbjct: 428 DLPMKKGIITN--------RNKFILGPSGSGKSFFTNHMVRQYYEQNAHVLLVDTGNSYL 479

Query: 468 --AEIFVRAGGGK---YKPLKNGQPTGIAP--LKGMEYTEKNKIFLRSWVLKLVTTEGQT 520
              E+  R   G+   Y       P    P  ++   +  + K  +++ +L L   + + 
Sbjct: 480 GLCEMINRKTHGEDGIYFTYTTENPIAFNPFYVEDGVFDIEKKESIKTLILTLWKRDDEA 539

Query: 521 VTEQERQDIAKAINS-LESLPHAQRSLGALQLFFDNTSKEGIA------IR--------- 564
            T  E   ++ A++S +E +            F++    +  A      +R         
Sbjct: 540 PTRAEEVALSNAVSSYIELITKDSSVTPCFNTFYEYVKNDYRAHLQEKNVREKDFDIDNF 599

Query: 565 ---LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE---EIRRPLMMYLFNRIL 618
              L+ + KG +  ++ ++D++   L  +FI +++ +  D++    I   ++M +F   +
Sbjct: 600 LNVLEPYYKGGEYDYLLNSDKELDLLHKRFIVFELDNIKDHKILFPITTIIIMEVFISKM 659

Query: 619 DLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIA-H 677
             + G R +I+I+E WKA+   +   + +   KT+RK  G  +  TQ  +D ++S I   
Sbjct: 660 RKLKGIRKLILIEEAWKAIASANMADYIKYLYKTVRKYFGEAIVVTQEVEDIISSPIVKE 719

Query: 678 TIIEQCPTQIFFPNQK-ANYKDYVED-FKLTERE 709
           +II     +I    +K  N  D +++   LT++E
Sbjct: 720 SIINNSDCKILLDQRKYLNKFDSIQNLLGLTDKE 753
>bfs:BF1241 conserved hypothetical protein found on conjugate transposon
          Length = 834

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 91/454 (20%), Positives = 183/454 (40%), Gaps = 55/454 (12%)

Query: 303 LDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAA 362
           ++E L++  S   +    H ++  ++D    L    +   + L                 
Sbjct: 308 IEEYLNEAHSQGLISVRCHCNIMAWSDDRDELKHIKNDVGSQLALMECKPRHNTTDTPTL 367

Query: 363 WWAQLPGN------------FSYRARSGAITSRNF-AALSPFHSFPIGKLEGNVWGAAVA 409
           +WA +PGN            F  +A        N+ ++LSPF    + ++ G      ++
Sbjct: 368 FWAGIPGNQADFPAEESFYTFIEQALCLFTEETNYKSSLSPFGIKMVDRVTGKPLHIDIS 427

Query: 410 LLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQG-- 467
            L  + G             N F+ GPSGSGK+   N ++ Q  + N  ++  D      
Sbjct: 428 DLPMKRGIITN--------RNKFILGPSGSGKSFFTNHMVRQYYEQNAHVLLVDTGNSYL 479

Query: 468 --AEIFVRAGGGK---YKPLKNGQPTGIAP--LKGMEYTEKNKIFLRSWVLKLVTTEGQT 520
              E+  R   G+   Y       P    P  ++   +  + K  +++ +L L   + + 
Sbjct: 480 GLCEMINRKTHGEDGIYFTYTTENPIAFNPFYVEDGVFDIEKKESIKTLILTLWKRDDEA 539

Query: 521 VTEQERQDIAKAINSLESLPHAQRSL-GALQLFFD-------------NTSKEGIAIR-- 564
            T  E   ++ A++S   L     S+      F++             N  ++   I   
Sbjct: 540 PTRAEEVALSNAVSSYIGLITKDCSVTPCFNTFYEYVRNDYRAHLQEKNVREKDFDIDNF 599

Query: 565 ---LQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE---EIRRPLMMYLFNRIL 618
              L+ + KG +  ++ ++D++   L  +FI +++ +  D++    I   ++M +F   +
Sbjct: 600 LNVLEPYYKGGEYDYLLNSDKELDLLHKRFIVFELDNIKDHKILFPITTIIIMEVFINKM 659

Query: 619 DLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIA-H 677
             + G R +I+I+E WKA+   +   + +   KT+RK  G  +  TQ  +D ++S I   
Sbjct: 660 RKLKGIRKLILIEEAWKAIASANMADYIKYLYKTVRKYFGEAIVVTQEVEDIISSPIVKE 719

Query: 678 TIIEQCPTQIFFPNQK-ANYKDYVED-FKLTERE 709
           +II     +I    +K  N  D +++   LT++E
Sbjct: 720 SIINNSDCKILLDQRKYLNKFDSIQNLLGLTDKE 753
>bch:Bcen2424_6801 conserved hypothetical protein
          Length = 864

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 75/289 (25%), Positives = 126/289 (43%), Gaps = 28/289 (9%)

Query: 405 GAAVALLKTQAGSPYYFNFHY-GDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFD 463
           G A  L   + G+P   + +  G   N FV G SG+GK+V++N ++   +     +   D
Sbjct: 466 GRANLLFFGRRGTPALVDIYSSGTNYNGFVDGTSGAGKSVLLNEIIGAFRSVGGIVRICD 525

Query: 464 KDQGAEIFVRAGGGKYKPLKNG--------QPTGIAPLKGMEYTEKNKIFLRSWVLKLVT 515
                E  +  G G+Y   K G           GI    G++   K   F+R  + ++V+
Sbjct: 526 VGYSYEKQIDMGDGQYIDFKPGSRIIINAFSTAGIDTENGLDSEVK---FIRPIIARMVS 582

Query: 516 -TEGQTVTEQERQDIAKAI----NSLESLPHAQRSLGALQLFFDNTSKEGI----AIRLQ 566
            T   T  E    D+A  I       E  P   R    L L   N   E I    A+RL+
Sbjct: 583 PTAPITPFEGALLDVAVRIVWKDYGQEGSPTLVRD-ALLSLKDQNGQPERIAYELAVRLE 641

Query: 567 RWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLI----D 622
            + KG   G  + N + +++LD++ +G ++     + ++R  +M+ L N++ + +     
Sbjct: 642 PFCKGGVYG-DYVNGRTNVSLDNEVVGLELEHLNSDPQLRTVIMLGLTNQVTNEMYRFDR 700

Query: 623 GRRIIIVIDEFWKALEDDSFKA-FAQDRLKTIRKQNGMMLFATQSPKDA 670
            R  + + DE W+ + DD   A F ++  +  RK  G   FATQ   DA
Sbjct: 701 SRPKLFLQDEGWQIVGDDQESADFMEEGYRRARKYEGSFFFATQGITDA 749
>hpa:HPAG1_0520 cag pathogenicity island protein E
          Length = 534

 Score = 61.6 bits (148), Expect = 7e-08
 Identities = 76/362 (20%), Positives = 140/362 (38%), Gaps = 31/362 (8%)

Query: 24  VIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVALYSHIIRRRETI 83
           VI  N+  L+  + + G++F T     L  LH  + ++ RN        Y H I+++  I
Sbjct: 175 VILTNNYSLLGTIKLGGIDFLTTSKKDLIELHASIYSVFRNFVTPEFKFYFHTIKKKIVI 234

Query: 84  YPESR-----FFSSFAATLDEKYKKKM---VSQELYRNDLFVSLLWNPTSGKTEQLASFF 135
              +R     F + F    +EK K++    +S  L      +  L  P   K     + F
Sbjct: 235 DETNRDYGLIFSNDFMRAYNEKQKRESFYDISFYLTIEQDLLDTLNEPVMNKKHFADNNF 294

Query: 136 QRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQSEFLHQL 195
           +   +  + + E   + I  IEEL       L  Y    L  Y  +GI++S+Q EF + L
Sbjct: 295 EEFQRIIRAKLENFKDRIELIEEL-------LSKYHPTRLKEYTKDGIIYSKQCEFYNFL 347

Query: 196 VGGRRERIPLTFGTIASTIYSDRVIFG---------KEMIEIRHESNERFVGMFGWKEYP 246
           VG         F      +Y    + G         K    +  + +E++       EY 
Sbjct: 348 VGMNE----APFICNRKDLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYA 403

Query: 247 SKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEA 306
            K++  + D +     EFI   ++  K+    +  +     ++I +    S +       
Sbjct: 404 PKSQSDLFDKINALDSEFIFMHAYSPKNSQVLKDKLAFTSRRIIISG--GSKEQGMTLGC 461

Query: 307 LDDLESN-RFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           L +L  N    LG +  SL +FAD  + + + + +  + L   G +       +E  ++A
Sbjct: 462 LSELVGNGDITLGSYGNSLVLFADSFEKMKQSVKECVSSLNAKGFLANAATFSMENYFFA 521

Query: 366 QL 367
            +
Sbjct: 522 NI 523
>rsp:RSP_4226 traC; TraC
          Length = 827

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 81/418 (19%), Positives = 163/418 (38%), Gaps = 45/418 (10%)

Query: 376 RSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDLGNTFVCG 435
           R   + S   +AL+P H    G+  G+  G  V LL  Q     + NF      N  V G
Sbjct: 403 RMKILKSEAASALAPIH----GEWTGSGNGRGVLLLGRQGQIMDWDNFASDGNYNVAVVG 458

Query: 436 PSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKG 495
            SG+GK+V +  L+  +      +V  D     +  V   GG +          + P   
Sbjct: 459 KSGAGKSVFMQELVTSIYAAGGRVVVIDDGYSFKNTVEILGGTFVGFDGSVQIRLNPFSM 518

Query: 496 MEYTEKNKIFLRSWVLKLVTT---------EGQT--VTEQERQDIAKAINSLESLPHAQR 544
           +   +  K   R+  ++LVT          EG+   V E E   I++ +  + +   A  
Sbjct: 519 LSAEDMEKDEYRADAIELVTGIIASMAALGEGKQSRVEEFEEGRISRIVADVWAEKGAAG 578

Query: 545 SLG----ALQLFFDNTSK-EGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDF 599
            +      L+ F +   +   + ++L+ + +    G  F      L L++ F  ++++D 
Sbjct: 579 EVTDVWERLRAFAEEDQRLADVVVKLEAFTRSGPYGHYFAGPAT-LRLETAFTVFELSDI 637

Query: 600 LDN---EEIRRPLMMYLFNRILDLIDGR-RIIIVIDEFWKALEDDSFKAFAQDRLKTIRK 655
                 +++   ++M+L   ++        + I+IDE W  L+  +   F +  ++  RK
Sbjct: 638 KGQKVLQDVVLQIVMFLGTELMFKTPRAVPVAILIDEAWDLLKSHATARFIEGVVRRARK 697

Query: 656 QNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQS 715
             G ++  TQS  D  N+  A   ++     +    +       V+D +L+      +  
Sbjct: 698 YTGALITGTQSIDDYYNNVAATVCLQNSDWTVLLAQKAETIDRLVQDRRLS------VSP 751

Query: 716 ELSRESRRFLIKQGQNSVVAELNLRGMND-----------EIAILSGTTKNIELVNQI 762
            ++ + +     Q    + +E+ ++G N             +AI S     +E +N++
Sbjct: 752 HIAGQLKSL---QSVKGLFSEMGVKGPNGWFFGRLLLDPFSLAIYSSKGSTVEKINRL 806
>eba:p1B154 traC; sex pilus assembly protein
          Length = 815

 Score = 55.1 bits (131), Expect = 7e-06
 Identities = 121/602 (20%), Positives = 234/602 (38%), Gaps = 101/602 (16%)

Query: 146 SEPDMEAIRKIEELSQDLIQGLES--YEARLLSVYAHEGILFS-----EQSEFLHQLVGG 198
           S PD+E  + I      +++G  S  ++ R+L  + +  ++       E+ EF +     
Sbjct: 154 SLPDLEERQSIRSDVTRVMEGFSSIGFQFRMLDPHGYLHLIRKFYHMWEKPEFSYD---- 209

Query: 199 RRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNER--FVGMFGWKEYPSKTRPGMTDG 256
             E IP+         Y    I  KE   + H+ +++  FV +   K +P +T  G+ + 
Sbjct: 210 --ELIPIR----EQAFYPGDDIEFKENEILFHQGSDQEFFVRVMSPKLFPKRTVFGVANL 263

Query: 257 LL----------TAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI------ 300
           L+          T PF F  T  +  + K    V   R+++  I      +S        
Sbjct: 264 LIGDQMGGANQITEPFFFQFTAHYPDQVKKKGEV---RQRHMWITQQCIGNSATWFPILG 320

Query: 301 ---DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDL 357
              + ++  + +++    +  E +LSL +F+     L    +   ++L+     +  +  
Sbjct: 321 YKKEGIETFIHEIDGQGGMALEVNLSLMIFSKNRDRLARQTASLNSYLSTLSFDMREDKR 380

Query: 358 GLEAAWWAQLPGNFSYRA-----RSGAITSRNFAALSPFHSFPIGKLEGNVWGA-AVALL 411
            L+  W   LP N S  A     R+  +++R  A L P  +   G       GA A +L 
Sbjct: 381 ILDFLWHNALPMNASADAMTRTFRTNTMSARQAAPLVPLFADYKGS------GANATSLF 434

Query: 412 KTQAGSPYYFNFHYGDLG-NTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEI 470
            T+ G    F+    + G N  V   +G GK+      LAQL      ++  +  +G ++
Sbjct: 435 VTRRGQVSAFSVWDSNTGYNVVVFAGTGGGKS-----FLAQL------VIVDNLAEGCKV 483

Query: 471 FVRAGGGKYKPLKNGQPTGIAPLKG--MEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQD 528
           +V   G  +  L          LKG  +E++E+++I L  +       E   + +     
Sbjct: 484 WVIDVGKSFFKLNRA-------LKGDYIEFSEESQIILNPFTFVSEIDEDIDIIKATIAK 536

Query: 529 IAKAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWI------KGNDLG------- 575
           +A     L+    A    G ++  +D  +       + +W       +  DLG       
Sbjct: 537 MAAPEGGLDDYQMAALEEG-IKATWDRYAHNSTVTAVAQWCMQQPDPRVRDLGQQLYPFT 595

Query: 576 -------WVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRI---LDLIDGRR 625
                  W     +  +++ ++F   D+        +++ +++ L NRI   +    GR+
Sbjct: 596 VSGSYGRWF--EGEATIDVSNRFTVLDLLHLKSRPILQKVVLLQLMNRIATEMYTTPGRK 653

Query: 626 IIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPT 685
           I+ V+DE W+ ++D       +   + +RK +G ++F TQ   D   S     I      
Sbjct: 654 IL-VLDEAWELMDDPLMAKAIEALYRKVRKNSGAVIFITQGVGDLFQSPNGRAIYANSAW 712

Query: 686 QI 687
           QI
Sbjct: 713 QI 714
  Database: genes
    Posted date:  Nov 30, 2006  4:11 PM
  Number of letters in database: 614,153,286
  Number of sequences in database:  1,720,133
  
Lambda     K      H
   0.320    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 902,944,348
Number of Sequences: 1720133
Number of extensions: 38230791
Number of successful extensions: 128318
Number of sequences better than 1.0e-05: 136
Number of HSP's better than  0.0 without gapping: 105
Number of HSP's successfully gapped in prelim test: 31
Number of HSP's that attempted gapping in prelim test: 127583
Number of HSP's gapped (non-prelim): 157
length of query: 784
length of database: 614,153,286
effective HSP length: 134
effective length of query: 650
effective length of database: 383,655,464
effective search space: 249376051600
effective search space used: 249376051600
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 130 (54.7 bits)