Blast Aminoacid

BLAST Search Results

BLASTP 2.2.3 [Apr-24-2002]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Database: SPROT 
           309,621 sequences; 115,465,120 total letters



Query= 689 (817 letters)

Distribution of 14 Blast Hits on the Query Sequence




                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|148841286|sp|Q9RPY1|VIRB4_BRUSU  Type IV secretion system...   565   e-160
gi|123545428|sp|Q2YIT8|VIRB4_BRUA2  Type IV secretion system...   564   e-160
gi|81850952|sp|Q8YDZ4|VIRB4_BRUME  Type IV secretion system ...   564   e-160
gi|81424215|sp|Q7VSX9|PTLC_BORPE  Type IV secretion system p...   547   e-155
gi|81425951|sp|Q7W2U3|PTLC_BORPA  Type IV secretion system p...   546   e-154
gi|81579548|sp|Q7WDU1|PTLC_BORBR  Type IV secretion system p...   545   e-154
gi|81858639|sp|Q9R2W4|VIRB4_BARHE  Type IV secretion system ...   520   e-146
gi|81827588|sp|Q6FYW7|VIRB4_BARQU  Type IV secretion system ...   513   e-144
gi|20141869|sp|P17794|VIRB4_AGRT5  Protein virB4 precursor        384   e-106
gi|61250192|sp|P0A3W0|VIRB4_AGRTU  Protein virB4 precursor >...   377   e-103
gi|2498200|sp|Q48252|CAGE_HELPY  CAG pathogenicity island pr...   234   1e-60
gi|12229774|sp|Q9ZLT4|CAGE_HELPJ  CAG pathogenicity island p...   234   2e-60
gi|2499046|sp|P55399|TRBE2_RHISN  Probable conjugal transfer...   124   2e-27
gi|1730021|sp|P54910|TRBE_AGRTU  Conjugal transfer protein t...   110   3e-23
>gi|148841286|sp|Q9RPY1|VIRB4_BRUSU Type IV secretion system protein virB4
          Length = 831

 Score =  565 bits (1457), Expect = e-160
 Identities = 328/820 (40%), Positives = 471/820 (57%), Gaps = 42/820 (5%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           ++ F+   + V P+ + T  GD++  W +AGL F  +D+ EL  R +  N L + + +  
Sbjct: 17  LAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEELLIRKDQLNTLFRAIASN- 75

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVT 127
             NVA W H+VRRR        F   F  AL  +YY + S  ++M NELY ++IYRPV  
Sbjct: 76  --NVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPA 133

Query: 128 G-KRLVEKSGDPDKIRVEEEQ--AIAKVIELATNVEAVLKDYSPYR------LGMYEAKN 178
              RL   +       + +EQ  AI K+ E+   +E  L+ Y          L  YE K+
Sbjct: 134 KISRLFNVAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKH 193

Query: 179 GVVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGA 238
           G + S+ LEF  +LL+   + V V   P+  YL         +T +  IRT +   +   
Sbjct: 194 GALCSQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIE--IRTANATRYARG 251

Query: 239 ILNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSS 298
           I + K+YA  T PGILNGL Y D+EYV+T SFS + + D  + L R K  + ++ D S+S
Sbjct: 252 I-DFKDYASHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSAS 310

Query: 299 QIRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLA 358
           QI ++D+A+D +  G+FV+GEYH+++ V+++  E +    +     L + GF+++    A
Sbjct: 311 QIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATA 370

Query: 359 IASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQP 418
             ++FY+QLP NWR+R R+A L+SLNF GLS  HNF  GK+  NPWG A+T L+T +GQP
Sbjct: 371 TDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQP 430

Query: 419 YYFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKF---DPVPTI-FFF 474
            Y NFH +   E++  +K +GNT +IG+SG GKT L+NF L+Q QK+    P+     FF
Sbjct: 431 AYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF 490

Query: 475 DKDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVLGGK--TEYSS 532
           DKD+GA+  + A GG YLA+ NG PTGFNPFQ E    N  FL +L++VL  +     ++
Sbjct: 491 DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTT 550

Query: 533 REEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGD-----DGLYARLRRWTAGNSLG--- 584
            +E  I  A+  ++     LR +S   +++    D     + +  RL +W   +  G   
Sbjct: 551 TDESRISHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRG 610

Query: 585 ---WVFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMD 641
              WV D P D ID    S  GFD TD +DN +VR P+  YLLHR+E  IDGR  IY MD
Sbjct: 611 TFWWVLDCPQDQIDFNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMD 670

Query: 642 EFWKILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLP 701
           E WK +D E    EFA NKQ TIRKQNGLG+FATQ P   L S +A+AL++Q AT + LP
Sbjct: 671 EAWKWVDDE-AFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLP 729

Query: 702 NPNASRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISS 761
           NP A   +Y DG K+T+ E+ ++ S+ E SR FLVKQGH S +C+L L G DD L+++S 
Sbjct: 730 NPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSG 789

Query: 762 STDNIEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           S+DN E++ Q+++         VG   P  WL  F   R+
Sbjct: 790 SSDNNELLDQVIA--------EVGD-DPSVWLPVFQERRK 820
>gi|123545428|sp|Q2YIT8|VIRB4_BRUA2 Type IV secretion system protein virB4
 gi|148841285|sp|P0C525|VIRB4_BRUAB Type IV secretion system protein virB4
          Length = 831

 Score =  564 bits (1454), Expect = e-160
 Identities = 327/820 (39%), Positives = 472/820 (56%), Gaps = 42/820 (5%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           ++ F+   + V P+ + T  GD++  W +AGL F  +D+ +L  R +  N L + + +  
Sbjct: 17  LAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASN- 75

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVT 127
             NVA W H+VRRR        F   F  AL  +YY + S  ++M NELY ++IYRPV  
Sbjct: 76  --NVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPA 133

Query: 128 G-KRLVEKSGDPDKIRVEEEQ--AIAKVIELATNVEAVLKDYSPYR------LGMYEAKN 178
              RL   +       + +EQ  AI K+ E+   +E  L+ Y          L  YE K+
Sbjct: 134 KISRLFNVAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKH 193

Query: 179 GVVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGA 238
           G + S+ LEF  +LL+   + V V   P+  YL         +T +  IRT +   +   
Sbjct: 194 GALCSQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIE--IRTANATRYARG 251

Query: 239 ILNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSS 298
           I + K+YA+ T PGILNGL Y D+EYV+T SFS + + D  + L R K  + ++ D S+S
Sbjct: 252 I-DFKDYANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSAS 310

Query: 299 QIRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLA 358
           QI ++D+A+D +  G+FV+GEYH+++ V+++  E +    +     L + GF+++    A
Sbjct: 311 QIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATA 370

Query: 359 IASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQP 418
             ++FY+QLP NWR+R R+A L+SLNF GLS  HNF  GK+  NPWG A+T L+T +GQP
Sbjct: 371 TDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQP 430

Query: 419 YYFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKF---DPVPTI-FFF 474
            Y NFH +   E++  +K +GNT +IG+SG GKT L+NF L+Q QK+    P+     FF
Sbjct: 431 AYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF 490

Query: 475 DKDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVLGGK--TEYSS 532
           DKD+GA+  + A GG YLA+ NG PTGFNPFQ E    N  FL +L++VL  +     ++
Sbjct: 491 DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTT 550

Query: 533 REEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGD-----DGLYARLRRWTAGNSLG--- 584
            +E  I  A+  ++     LR +S   +++    D     + +  RL +W   +  G   
Sbjct: 551 TDESRISHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRG 610

Query: 585 ---WVFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMD 641
              WV D P D ID    S  GFD TD +DN +VR P+  YLLHR+E  IDGR  IY MD
Sbjct: 611 TFWWVLDCPQDQIDFNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMD 670

Query: 642 EFWKILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLP 701
           E WK +D E    EFA NKQ TIRKQNGLG+FATQ P   L S +A+AL++Q AT + LP
Sbjct: 671 EAWKWVDDE-AFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLP 729

Query: 702 NPNASRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISS 761
           NP A   +Y DG K+T+ E+ ++ S+ E SR FLVKQGH S +C+L L G DD L+++S 
Sbjct: 730 NPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSG 789

Query: 762 STDNIEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           S+DN E++ Q+++         VG   P  WL  F   R+
Sbjct: 790 SSDNNELLDQVIA--------EVGD-DPSVWLPVFQERRK 820
>gi|81850952|sp|Q8YDZ4|VIRB4_BRUME Type IV secretion system protein virB4
          Length = 831

 Score =  564 bits (1453), Expect = e-160
 Identities = 327/820 (39%), Positives = 471/820 (56%), Gaps = 42/820 (5%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           ++ F+   + V P+ + T  GD++  W +AGL F  +D+ +L  R +  N L + + +  
Sbjct: 17  LAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASN- 75

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVT 127
             NVA W H+VRRR        F   F  AL  +YY + S  ++M NELY ++IYRPV  
Sbjct: 76  --NVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPA 133

Query: 128 G-KRLVEKSGDPDKIRVEEEQ--AIAKVIELATNVEAVLKDYSPYR------LGMYEAKN 178
              RL   +       + +EQ  AI K+ E+   +E  L+ Y          L  YE K+
Sbjct: 134 KISRLFNVAVHRSHAEILQEQKLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKH 193

Query: 179 GVVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGA 238
           G + S+ LEF  +LL+   + V V   P+  YL         +T +  IRT     +   
Sbjct: 194 GALCSQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIE--IRTASATRYARG 251

Query: 239 ILNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSS 298
           I + K+YA+ T PGILNGL Y D+EYV+T SFS + + D  + L R K  + ++ D S+S
Sbjct: 252 I-DFKDYANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSAS 310

Query: 299 QIRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLA 358
           QI ++D+A+D +  G+FV+GEYH+++ V+++  E +    +     L + GF+++    A
Sbjct: 311 QIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATA 370

Query: 359 IASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQP 418
             ++FY+QLP NWR+R R+A L+SLNF GLS  HNF  GK+  NPWG A+T L+T +GQP
Sbjct: 371 TDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQP 430

Query: 419 YYFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKF---DPVPTI-FFF 474
            Y NFH +   E++  +K +GNT +IG+SG GKT L+NF L+Q QK+    P+     FF
Sbjct: 431 AYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF 490

Query: 475 DKDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVLGGK--TEYSS 532
           DKD+GA+  + A GG YLA+ NG PTGFNPFQ E    N  FL +L++VL  +     ++
Sbjct: 491 DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTT 550

Query: 533 REEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGD-----DGLYARLRRWTAGNSLG--- 584
            +E  I  A+  ++     LR +S   +++    D     + +  RL +W   +  G   
Sbjct: 551 TDESRISHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRG 610

Query: 585 ---WVFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMD 641
              WV D P D ID    S  GFD TD +DN +VR P+  YLLHR+E  IDGR  IY MD
Sbjct: 611 TFWWVLDCPQDQIDFNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMD 670

Query: 642 EFWKILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLP 701
           E WK +D E    EFA NKQ TIRKQNGLG+FATQ P   L S +A+AL++Q AT + LP
Sbjct: 671 EAWKWVDDE-AFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLP 729

Query: 702 NPNASRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISS 761
           NP A   +Y DG K+T+ E+ ++ S+ E SR FLVKQGH S +C+L L G DD L+++S 
Sbjct: 730 NPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSG 789

Query: 762 STDNIEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           S+DN E++ Q+++         VG   P  WL  F   R+
Sbjct: 790 SSDNNELLDQVIA--------EVGD-DPSVWLPVFQERRK 820
>gi|81424215|sp|Q7VSX9|PTLC_BORPE Type IV secretion system protein ptlC (Pertussis toxin liberation
           protein C)
          Length = 824

 Score =  547 bits (1409), Expect = e-155
 Identities = 310/816 (37%), Positives = 455/816 (54%), Gaps = 40/816 (4%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           I+ F+  S+H+  + L T G D +  W + G+ F   +   + QRH   N L    RA  
Sbjct: 20  IAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL---WRAIS 76

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRP--V 125
              VA W+H +RR+ + G   R++  F +AL   Y A L++++ M NE Y +++YRP   
Sbjct: 77  CEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVYRPGHA 136

Query: 126 VTGKRLVEKSGDPDKIRVEEEQAIAKVIELATNVEAVLKDYSPYR------LGMYEAKNG 179
             GKR      +   +R +    + ++ E+ + +E  L+ +          LG      G
Sbjct: 137 ALGKRAHHGQAE---VRRQLLAHVRRMDEIGSLIETTLRSHGENHEQAITVLGCETDSAG 193

Query: 180 VVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAI 239
             +S TL  L +LL    +PV V   PV AYL  S+ +   +  +  +R P     +   
Sbjct: 194 RRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMME--LRAPT-CRRYAQF 250

Query: 240 LNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQ 299
           ++ KEY   T PG+LN L Y D+EYV+THSFS VG+  AL  L+R +  + +  D + SQ
Sbjct: 251 IDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQDAAYSQ 310

Query: 300 IRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAI 359
           I DL  A D + +G+FV+GEYHF++ +      +L R +++    +   GF+++   LA+
Sbjct: 311 IDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATPVTLAL 370

Query: 360 ASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPY 419
            ++FY+QLP NW +R+R A L+S NF GL   HNF  GK+  NPWG A++ L T +GQP+
Sbjct: 371 DAAFYAQLPANWAYRSRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTPSGQPF 430

Query: 420 YFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVP----TIFFFD 475
           YFNFH +   E+  G+  +GNT +IG+SG+GKT L+NFLL Q+QKF        T  FFD
Sbjct: 431 YFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLTTIFFD 490

Query: 476 KDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVL--GGKTEYSSR 533
           KDRGAEI +RA  G YL + +G PTGFNP Q    + N  FL  L+ +L     +  +S 
Sbjct: 491 KDRGAEICIRALDGQYLRIRDGEPTGFNPLQLPCTDRNVMFLDSLLAMLARAHDSPLTSA 550

Query: 534 EEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGDD--GLYARLRRWTAGNSLG------W 585
           +   +  AV  +L  P  LR MS   +++     +   L  RL RW   +  G      W
Sbjct: 551 QHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGGTGMLWW 610

Query: 586 VFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWK 645
           VFDNP D +D +R    G D T  +DN E R P+  YLLHR+   +DGR  +Y+MDE WK
Sbjct: 611 VFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYLMDEAWK 670

Query: 646 ILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNA 705
            +D +    EFA ++Q TIRK+NGLG+F+TQ P   L + +AA+L++Q AT + LPNP A
Sbjct: 671 WID-DPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYLPNPRA 729

Query: 706 SRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDN 765
            R +Y+DG K T+ EYQ++ S+ E S  FLVKQG  + V QL+L GMDD L+++S +  N
Sbjct: 730 DRAEYLDGFKCTETEYQLIRSMAEDSHLFLVKQGRQAVVAQLDLSGMDDELAILSGNARN 789

Query: 766 IEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           +    Q L+           +  P  W+  F+  RR
Sbjct: 790 LRCFEQALA--------LTRERDPNDWIAVFHRLRR 817
>gi|81425951|sp|Q7W2U3|PTLC_BORPA Type IV secretion system protein ptlC homolog
          Length = 824

 Score =  546 bits (1408), Expect = e-154
 Identities = 310/816 (37%), Positives = 455/816 (54%), Gaps = 40/816 (4%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           I+ F+  S+H+  + L T G D +  W + G+ F   +   + QRH   N L    RA  
Sbjct: 20  IAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL---WRAIS 76

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRP--V 125
              VA W+H +RR+ + G   R++  F +AL   Y A L++++ M NE Y +++YRP   
Sbjct: 77  CEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVYRPGHA 136

Query: 126 VTGKRLVEKSGDPDKIRVEEEQAIAKVIELATNVEAVLKDYSPYR------LGMYEAKNG 179
             GKR      +   +R +    + ++ E+ + +E  L+ +          LG      G
Sbjct: 137 ALGKRAHHGQAE---VRRQLLAHVRRMDEIGSLIETTLRSHGENHEQAITVLGCETDSAG 193

Query: 180 VVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAI 239
             +S TL  L +LL    +PV V   PV AYL  S+ +   +  +  +R+P     +   
Sbjct: 194 RRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMME--LRSPT-CRRYAQF 250

Query: 240 LNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQ 299
           ++ KEY   T PG+LN L Y D+EYV+THSFS VG+  AL  L+R +  + +  D + SQ
Sbjct: 251 IDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQDAAYSQ 310

Query: 300 IRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAI 359
           I DL  A D + +G+FV+GEYHF++ +      +L R +++    +   GF+++   LA+
Sbjct: 311 IDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATPVTLAL 370

Query: 360 ASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPY 419
            ++FY+QLP NW +R R A L+S NF GL   HNF  GK+  NPWG A++ L T +GQP+
Sbjct: 371 DAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTPSGQPF 430

Query: 420 YFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVP----TIFFFD 475
           YFNFH +   E+  G+  +GNT +IG+SG+GKT L+NFLL Q+QKF        T  FFD
Sbjct: 431 YFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLTTIFFD 490

Query: 476 KDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVL--GGKTEYSSR 533
           KDRGAEI +RA  G YL + +G PTGFNP Q    + N  FL  L+ +L     +  +S 
Sbjct: 491 KDRGAEICIRALDGQYLRIRDGEPTGFNPLQLPCTDRNVMFLDSLLAMLARAHDSPLTSA 550

Query: 534 EEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGDD--GLYARLRRWTAGNSLG------W 585
           +   +  AV  +L  P  LR MS   +++     +   L  RL RW   +  G      W
Sbjct: 551 QHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGGTGMLWW 610

Query: 586 VFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWK 645
           VFDNP D +D +R    G D T  +DN E R P+  YLLHR+   +DGR  +Y+MDE WK
Sbjct: 611 VFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYLMDEAWK 670

Query: 646 ILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNA 705
            +D +    EFA ++Q TIRK+NGLG+F+TQ P   L + +AA+L++Q AT + LPNP A
Sbjct: 671 WID-DPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYLPNPRA 729

Query: 706 SRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDN 765
            R +Y+DG K T+ EYQ++ S+ E S  FLVKQG  + V QL+L GMDD L+++S +  N
Sbjct: 730 DRAEYLDGFKCTETEYQLIRSMAEDSHLFLVKQGRQAVVAQLDLSGMDDELAILSGNARN 789

Query: 766 IEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           +    Q L+           +  P  W+  F+  RR
Sbjct: 790 LRCFEQALA--------LTRERDPNDWIAVFHRLRR 817
>gi|81579548|sp|Q7WDU1|PTLC_BORBR Type IV secretion system protein ptlC homolog
          Length = 824

 Score =  545 bits (1404), Expect = e-154
 Identities = 309/816 (37%), Positives = 455/816 (54%), Gaps = 40/816 (4%)

Query: 8   ISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPD 67
           I+ F+  S+H+  + L T G D +  W + G+ F   +   + QRH   N L    RA  
Sbjct: 20  IAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL---WRAIS 76

Query: 68  FANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRP--V 125
              VA W+H +RR+ + G   R++  F +AL   Y A L++++ M NE Y +++YRP   
Sbjct: 77  CEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVYRPGHA 136

Query: 126 VTGKRLVEKSGDPDKIRVEEEQAIAKVIELATNVEAVLKDYSPYR------LGMYEAKNG 179
             GKR      +   +R +    + ++ E+ + +E  L+ +          LG      G
Sbjct: 137 ALGKRAHHGQAE---VRRQLLAHVRRMDEIGSLIETTLRSHGEDHEQAITVLGCETDSAG 193

Query: 180 VVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAI 239
             +S TL  L +LL    +PV V   P+ AYL  S+ +   +  +  +R+P     +   
Sbjct: 194 RRYSRTLTLLEFLLTGHWQPVRVPAGPLDAYLGSSRILAGAEMME--LRSPT-CRRYAQF 250

Query: 240 LNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQ 299
           ++ KEY   T PG+LN L Y D+EYV+THSFS VG+  AL  L+R +  + +  D + SQ
Sbjct: 251 IDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQDAAYSQ 310

Query: 300 IRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAI 359
           I DL  A D + +G+FV+GEYHF++ +      +L R +++    +   GF+++   LA+
Sbjct: 311 IDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATPVTLAL 370

Query: 360 ASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPY 419
            ++FY+QLP NW +R R A L+S NF GL   HNF  GK+  NPWG A++ L T +GQP+
Sbjct: 371 DAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTPSGQPF 430

Query: 420 YFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVP----TIFFFD 475
           YFNFH +   E+  G+  +GNT +IG+SG+GKT L+NFLL Q+QKF        T  FFD
Sbjct: 431 YFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLTTIFFD 490

Query: 476 KDRGAEIFVRACGGNYLALENGSPTGFNPFQCESNEVNTQFLAELIKVL--GGKTEYSSR 533
           KDRGAEI +RA  G YL + +G PTGFNP Q    + N  FL  L+ +L     +  +S 
Sbjct: 491 KDRGAEICIRALDGQYLRIRDGEPTGFNPLQLPCTDRNVMFLDSLLAMLARAHDSPLTSA 550

Query: 534 EEEDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGDD--GLYARLRRWTAGNSLG------W 585
           +   +  AV  +L  P  LR MS   +++     +   L  RL RW   +  G      W
Sbjct: 551 QHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGGTGMLWW 610

Query: 586 VFDNPVDTIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWK 645
           VFDNP D +D +R    G D T  +DN E R P+  YLLHR+   +DGR  +Y+MDE WK
Sbjct: 611 VFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYLMDEAWK 670

Query: 646 ILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNA 705
            +D +    EFA ++Q TIRK+NGLG+F+TQ P   L + +AA+L++Q AT + LPNP A
Sbjct: 671 WID-DPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYLPNPRA 729

Query: 706 SRDDYIDGLKLTDAEYQVVVSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDN 765
            R +Y+DG K T+ EYQ++ S+ E S  FLVKQG  + V QL+L GMDD L+++S +  N
Sbjct: 730 DRAEYLDGFKCTETEYQLIRSMAEDSHLFLVKQGRQAVVAQLDLSGMDDELAILSGNARN 789

Query: 766 IEIMHQILSRKAGKLGVSVGQLTPEQWLEDFYANRR 801
           +    Q L+           +  P  W+  F+  RR
Sbjct: 790 LRCFEQALA--------LTRERDPNDWIAVFHRLRR 817
>gi|81858639|sp|Q9R2W4|VIRB4_BARHE Type IV secretion system protein virB4
          Length = 784

 Score =  520 bits (1339), Expect = e-146
 Identities = 305/809 (37%), Positives = 470/809 (57%), Gaps = 39/809 (4%)

Query: 1   MFSPDSPISEFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLV 60
           M   +S   +++    H+   V+       + +  + G+ F   D  +L   HN  N L+
Sbjct: 3   MMKRESLPEDYIPYIRHINQHVIALNSRCLMTVMVVEGVNFDTADIDQLNSLHNQLNTLL 62

Query: 61  QTLRAPDFANVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSM 120
           + +       VA + H +RRR  I    +F  SF   L ++Y   + SQ++ +N+L+ S+
Sbjct: 63  KNIADE---RVALYSHIIRRRETIYPESQFFSSFAATLDEKYKKKMVSQELYRNDLFVSL 119

Query: 121 IYRPVVTGKRLV----EKSGDPDKIRVEEEQ-AIAKVIELATNVEAVLKDYSPYRLGMYE 175
           ++ P       +    ++     K + E +Q AI K+ EL+ ++   L+ Y    L +Y 
Sbjct: 120 LWNPASDKTEQLASFFQRLAKAKKTQSEPDQEAIRKIEELSQDLIEGLESYGARLLSVY- 178

Query: 176 AKNGVVFSETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINH 235
           A  G++FSE  EFL  L+    E +P+    +A+ +   + +F  +T +      +    
Sbjct: 179 AHGGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKETIEI---RHESNER 235

Query: 236 FGAILNVKEYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDK 295
           F  +   KEY   T PG+ +GL    FE+++T SF    +  A  ++ R +  MI++ D+
Sbjct: 236 FAGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAASVIMGRKQNQMINAADR 295

Query: 296 SSSQIRDLDLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKE 355
           +SSQI  LD A+DD+ S  FVLGE+H ++AV+++  + LA  ++  RA L+N G V ++E
Sbjct: 296 ASSQIEALDEALDDLESNRFVLGEHHLSLAVFANHPKALAEYLSKARAHLTNGGAVIARE 355

Query: 356 DLAIASSFYSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTN 415
           DL + +++++QLPGN+ +R R   ++S NF  LSP H+F  GK   N WG AV  L+T  
Sbjct: 356 DLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGTAVALLKTQA 415

Query: 416 GQPYYFNFHATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVPTIFFFD 475
           G PYYFNFH         G+  +GNT V G SG+GKT ++NFLL+Q+QK +  PT+ FFD
Sbjct: 416 GSPYYFNFH--------YGD--LGNTFVCGPSGSGKTVIVNFLLAQLQKHN--PTMVFFD 463

Query: 476 KDRGAEIFVRACGGNYLALENGSPTGFNPFQ-CESNEVNTQFLAE-LIKVLGGKTEYSSR 533
           KD+GAEIFVRA GG Y  L+NG PTG  P +  E  E N  FL   ++K++  + +  + 
Sbjct: 464 KDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKVFLRNWVLKLVTAEGQTVTE 523

Query: 534 EE-EDIYRAVGGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVD 592
           EE +DI +A+  + + P   RS+S  +    N   +G+  RL+RW  GN LGWVFDN  D
Sbjct: 524 EERQDIAKAIDALGNLPHAQRSLSALQLFFDNTSKEGIAIRLQRWLKGNDLGWVFDNDQD 583

Query: 593 TIDLTRASIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGG 652
            ++L  +  IG+D TD +DN E+R P++ YL +R+  LIDGR +I V+DEFWK L+ +  
Sbjct: 584 DLNLD-SQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE-DDS 641

Query: 653 LKEFAKNKQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYID 712
            K FA+++ KTIRKQNG+ +FATQSP+DAL S IA  +IEQ  T +  PN  A+  DY++
Sbjct: 642 FKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVE 701

Query: 713 GLKLTDAEYQVVVS-LDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQ 771
             KLT+ E++++ S L   SR FL+KQG +S V +LNLRGM+D ++V+S +T NIE+++Q
Sbjct: 702 DFKLTEREFELIQSELSRESRRFLIKQGQSSVVAELNLRGMNDEIAVLSGTTKNIELVNQ 761

Query: 772 ILSRKAGKLGVSVGQLTPEQWLEDFYANR 800
           I+S              P+ WL  F+  R
Sbjct: 762 IISEYGA---------DPDIWLPIFHQRR 781
>gi|81827588|sp|Q6FYW7|VIRB4_BARQU Type IV secretion system protein virB4
          Length = 784

 Score =  513 bits (1321), Expect = e-144
 Identities = 304/802 (37%), Positives = 461/802 (56%), Gaps = 43/802 (5%)

Query: 10  EFVSISTHVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPDFA 69
           E++    HV   V+       + +  + G+ F   D   L   HN  N L++ +      
Sbjct: 12  EYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADE--- 68

Query: 70  NVAFWVHDVRRRRKIGNSGRFKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVTGK 129
            VA + H +RRR  I    RF  SF   L ++Y   + SQ++ +N+L+ S+++ P  +GK
Sbjct: 69  RVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPT-SGK 127

Query: 130 R-----LVEKSGDPDKIRVEEE-QAIAKVIELATNVEAVLKDYSPYRLGMYEAKNGVVFS 183
                   ++     K + E + +AI K+ EL+ ++   L+ Y    L +Y A  G++FS
Sbjct: 128 TEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVY-AHEGILFS 186

Query: 184 ETLEFLGYLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNVK 243
           E  EFL  L+    E +P+    +A+ +   + +F     + +    +    F  +   K
Sbjct: 187 EQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGK---EMIEIRHESNERFVGMFGWK 243

Query: 244 EYADGTYPGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQIRDL 303
           EY   T PG+ +GL    FE+++T SF    +  A  ++ R +  MI++ D++SSQI  L
Sbjct: 244 EYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDAL 303

Query: 304 DLAMDDVASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAIASSF 363
           D A+DD+ S  FVLGE+H ++AV++D  + L   ++  RA L+N G V ++EDL + +++
Sbjct: 304 DEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAW 363

Query: 364 YSQLPGNWRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPYYFNF 423
           ++QLPGN+ +R R   ++S NF  LSP H+F  GK   N WG AV  L+T  G PYYFNF
Sbjct: 364 WAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNF 423

Query: 424 HATHPAENSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQKFDPVPTIFFFDKDRGAEIF 483
           H         G+  +GNT V G SG+GKT ++NFLL+Q+QK +  PT+ FFDKD+GAEIF
Sbjct: 424 H--------YGD--LGNTFVCGPSGSGKTVIVNFLLAQLQKHN--PTMVFFDKDQGAEIF 471

Query: 484 VRACGGNYLALENGSPTGFNPFQ-CESNEVNTQFLAELIKVL---GGKTEYSSREEEDIY 539
           VRA GG Y  L+NG PTG  P +  E  E N  FL   +  L    G+T  + +E +DI 
Sbjct: 472 VRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQT-VTEQERQDIA 530

Query: 540 RAVGGMLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRA 599
           +A+  +   P   RS+   +    N   +G+  RL+RW  GN LGWVFDN  D ++L  +
Sbjct: 531 KAINSLESLPHAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLD-S 589

Query: 600 SIIGFDYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGGLKEFAKN 659
             IG+D TD +DN E+R P++ YL +R+  LIDGR +I V+DEFWK L+ +   K FA++
Sbjct: 590 QFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALE-DDSFKAFAQD 648

Query: 660 KQKTIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYIDGLKLTDA 719
           + KTIRKQNG+ +FATQSP+DAL S IA  +IEQ  T +  PN  A+  DY++  KLT+ 
Sbjct: 649 RLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTER 708

Query: 720 EYQVVVS-LDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILSRKAG 778
           E++++ S L   SR FL+KQG  S V +LNLRGM+D ++++S +T NIE+++QI++    
Sbjct: 709 EFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGA 768

Query: 779 KLGVSVGQLTPEQWLEDFYANR 800
                     P+ WL  F+  R
Sbjct: 769 ---------DPDTWLPIFHQRR 781
>gi|20141869|sp|P17794|VIRB4_AGRT5 Protein virB4 precursor
          Length = 789

 Score =  384 bits (987), Expect = e-106
 Identities = 266/794 (33%), Positives = 414/794 (51%), Gaps = 44/794 (5%)

Query: 17  HVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQRHNTFNRLVQTLRAPDFANVAFWVH 76
           HV+  ++    G  + + H++G+ F   D      R   FN L++ + A D  +V+ + H
Sbjct: 21  HVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNI-ADD--HVSIYAH 77

Query: 77  DVRRRRKIGNSGR-FKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRPVVTGKRLVEKS 135
            VR      +  R F+ +F+ +LS+ +   + S K+++N+ + ++I  P     ++  + 
Sbjct: 78  LVRHDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRF 137

Query: 136 GDPDKIRVEEEQAIAKVIE-LATNVEAVLKDYSPYRLGMYEAKNGVVFSETLEFLGYLLN 194
               + +  +  A  + +E L   V   L+ Y   RLG+ E K  V+F+E  E L  ++ 
Sbjct: 138 TKRYRQKENDLTAQTRNLEDLWHLVAGALEAYGLRRLGIRE-KQDVLFTEVGEALRLIMT 196

Query: 195 RIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNVKEYADGTYPGIL 254
               PVPV+   + A +   + +   K G   IRTP   ++ G+I + +EY   T PG+L
Sbjct: 197 GRFTPVPVVSGSLGASIYTDR-VICGKRG-LEIRTPKD-SYVGSIYSFREYPATTRPGML 253

Query: 255 NGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQIRDLDLAMDDVASGN 314
           N L  LDF  V+T SFS + R  A   L      M+SSGDK+ +QI  L  A D +AS  
Sbjct: 254 NVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASNE 313

Query: 315 FVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAIASSFYSQLPGNWRFR 374
           FVLG +H ++ +Y++    LA + A  R  L++AG V  +E + + ++++SQLPGN+++R
Sbjct: 314 FVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWR 373

Query: 375 TRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPYYFNFHATHPAENSLG 434
           TR   ++S NF GL    NF +G    + WG+A+   +T  G P+ +  H          
Sbjct: 374 TRPGAITSRNFAGLVSFENFPEGSGSGH-WGNAIARFRTNGGTPFDYIPH---------- 422

Query: 435 EKAIGNTMVIGKSGTGKTALINFLLSQVQK--FDPVPTIFFFDKDRGAEIFVRACGGNYL 492
           E  +G T + G  G GKT L+ F+L+ +++   D    +  FDKDRG+E+ VRA GG YL
Sbjct: 423 EHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSELLVRATGGTYL 482

Query: 493 ALENGSPTGFNPFQ-CESNEVNTQFLAELIKVL---GGKTEYSSREEEDIYRAVGGMLDT 548
           AL  G+P+G  P +  E+   +  FL E I  L    G+   S  E   + R +   L  
Sbjct: 483 ALRRGAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSF 542

Query: 549 PMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRASIIGFDYTD 608
             H+RS++  R+ L +   +G  ARL+RW  GN+LGW FD  +D + L   SI GFD T 
Sbjct: 543 DPHMRSIAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLD-PSITGFDMTH 601

Query: 609 VIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGGLKEFAKNKQK---TIR 665
           +++  EV      YLLHR+ A++DGR  +   DEF   L       +FA    K   T+R
Sbjct: 602 LLEYEEVCAAAAAYLLHRIGAMVDGRRFVMSCDEFRAYLLN----PKFAAVVDKFLLTVR 657

Query: 666 KQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYIDGLKLTDAEYQVV- 724
           K NG+ I ATQ PE  L S + A+L+ Q  T +  P+P A R  YIDGLK T+ E+Q + 
Sbjct: 658 KNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIR 717

Query: 725 VSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILSRKAGKLGVSV 784
             +   SR FL+K+   S VC+ +LR M + ++V+S   + +    Q+  RK       V
Sbjct: 718 EDMAVGSRKFLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQL--RK-------V 768

Query: 785 GQLTPEQWLEDFYA 798
               P  WL +F A
Sbjct: 769 QGDNPSAWLSEFMA 782
>gi|61250192|sp|P0A3W0|VIRB4_AGRTU Protein virB4 precursor
 gi|61250194|sp|P0A3W1|VIRB4_AGRT9 Protein virB4 precursor
          Length = 789

 Score =  377 bits (968), Expect = e-103
 Identities = 265/798 (33%), Positives = 413/798 (51%), Gaps = 52/798 (6%)

Query: 17  HVAPSVLKTTGGDYLLIWHLAGLPFVGRDEFELEQ-RHNTFNRLVQTLRAPDFANVAFWV 75
           H++  ++    G  + I  + G+ F   +E E+   R   FN L++ + A D  +V+ + 
Sbjct: 21  HLSDHIVLLEDGSIMSIARIDGVAFE-LEEIEMRNARCRAFNTLLRNI-ADD--HVSIYA 76

Query: 76  HDVRRRRKIGNSGR-FKQSFNQALSDEYYAALSSQKIMQNELYFSMIYRP-VVTGK---R 130
           H VR      ++ R F+  F  +L++ +   + S ++++N+ + ++I  P    GK   R
Sbjct: 77  HLVRHADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNDHFLTLIVYPQAALGKVKRR 136

Query: 131 LVEKSGDPDKIRVEEEQAIAKVIELATNVEAVLKDYSPYRLGMYEAKNGVVFSETLEFLG 190
             + SG  +     +   I  + +L   V   LK Y  +RLG+ E K GV+F+E  E L 
Sbjct: 137 FTKLSGKRENDLAGQ---IRNMEDLWHVVAGSLKAYGLHRLGIRE-KQGVLFTEIGEALR 192

Query: 191 YLLNRIDEPVPVLQAPVAAYLPVSKHMFANKTGDFVIRTPDGINHFGAILNVKEYADGTY 250
            ++     PVPV+   + A +   + +   K G   IRTP   ++ G+I + +EY   T 
Sbjct: 193 LIMTGRFTPVPVVSGSLGASIYTDR-VICGKRG-LEIRTPKD-SYVGSIYSFREYPAKTR 249

Query: 251 PGILNGLKYLDFEYVVTHSFSPVGRHDALKVLERTKGMMISSGDKSSSQIRDLDLAMDDV 310
           PG+LN L  LDF  V+T SFS + R  A   L      M+SSGDK+ +QI  L  A D +
Sbjct: 250 PGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDAL 309

Query: 311 ASGNFVLGEYHFTVAVYSDSQEKLARQIATTRAELSNAGFVSSKEDLAIASSFYSQLPGN 370
           AS  FV+G +H ++ VY+D    L  + A  R  +++AG V  +E + + ++++SQLPGN
Sbjct: 310 ASNEFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGN 369

Query: 371 WRFRTRIANLSSLNFLGLSPLHNFAQGKQHNNPWGDAVTTLQTTNGQPYYFNFHATHPAE 430
           +++RTR   ++S NF G     NF +G    + WG A+   +T  G P+ +  H      
Sbjct: 370 FKWRTRPGAITSRNFAGFVSFENFPEGASSGH-WGTAIARFRTNGGTPFDYIPH------ 422

Query: 431 NSLGEKAIGNTMVIGKSGTGKTALINFLLSQVQK--FDPVPTIFFFDKDRGAEIFVRACG 488
               E  +G T + G  G GKT L+ F+L+ +++   D   T+ FFDKDRG E+ VRA G
Sbjct: 423 ----EHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGELLVRATG 478

Query: 489 GNYLALENGSPTGFNPFQ-CESNEVNTQFLAELIKVL---GGKTEYSSREEEDIYRAVGG 544
           G YLAL  G+P+G  P +  E+   +  FL E I  L    G+   S  E   + R +  
Sbjct: 479 GTYLALRRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHR 538

Query: 545 MLDTPMHLRSMSNFRKSLPNMGDDGLYARLRRWTAGNSLGWVFDNPVDTIDLTRASIIGF 604
            L     +RS++  R+ L +   +G  ARL+RW  G++LGW FD  VD + L   SI GF
Sbjct: 539 QLSFDPQMRSIAGLREFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLD-PSITGF 597

Query: 605 DYTDVIDNVEVRVPVINYLLHRLEALIDGRPLIYVMDEFWKILDGEGGLKEFAKNKQK-- 662
           D T +++  EV  P   YLLHR+ A+IDGR  +   DEF   L       +F+    K  
Sbjct: 598 DMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMSCDEFRAYLLN----PKFSAVVDKFL 653

Query: 663 -TIRKQNGLGIFATQSPEDALASDIAAALIEQTATMVLLPNPNASRDDYIDGLKLTDAEY 721
            T+RK NG+ I ATQ PE  L S + A+L+ Q  T +  P+P A R  YIDGLK T+ E+
Sbjct: 654 LTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEF 713

Query: 722 QVV-VSLDERSRCFLVKQGHASAVCQLNLRGMDDALSVISSSTDNIEIMHQILSRKAGKL 780
           Q +   +   SR FL+K+   S +C+ +LR M + ++V+S   + +    ++   + G  
Sbjct: 714 QAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFAARLREAQEG-- 771

Query: 781 GVSVGQLTPEQWLEDFYA 798
                      WL +F A
Sbjct: 772 -------NSSGWLSEFMA 782
  Database: SPROT
    Posted date:  Mar 11, 2008  6:16 PM
  Number of letters in database: 115,465,120
  Number of sequences in database:  309,621
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 188,324,420
Number of Sequences: 309621
Number of extensions: 8421877
Number of successful extensions: 23670
Number of sequences better than 1.0e-05: 14
Number of HSP's better than  0.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 23569
Number of HSP's gapped (non-prelim): 14
length of query: 817
length of database: 115,465,120
effective HSP length: 123
effective length of query: 694
effective length of database: 77,381,737
effective search space: 53702925478
effective search space used: 53702925478
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 124 (52.4 bits)