Blast Aminoacid

BLAST Search Results

BLASTP 2.2.3 [Apr-24-2002]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Database: SPROT 
           309,621 sequences; 115,465,120 total letters



Query= 284 (784 letters)

Distribution of 14 Blast Hits on the Query Sequence




                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|81827588|sp|Q6FYW7|VIRB4_BARQU  Type IV secretion system ...  1560   0.0  
gi|81858639|sp|Q9R2W4|VIRB4_BARHE  Type IV secretion system ...  1494   0.0  
gi|61250192|sp|P0A3W0|VIRB4_AGRTU  Protein virB4 precursor >...   571   e-162
gi|20141869|sp|P17794|VIRB4_AGRT5  Protein virB4 precursor        570   e-162
gi|148841286|sp|Q9RPY1|VIRB4_BRUSU  Type IV secretion system...   525   e-148
gi|81850952|sp|Q8YDZ4|VIRB4_BRUME  Type IV secretion system ...   524   e-148
gi|123545428|sp|Q2YIT8|VIRB4_BRUA2  Type IV secretion system...   523   e-147
gi|81424215|sp|Q7VSX9|PTLC_BORPE  Type IV secretion system p...   490   e-137
gi|81425951|sp|Q7W2U3|PTLC_BORPA  Type IV secretion system p...   490   e-137
gi|81579548|sp|Q7WDU1|PTLC_BORBR  Type IV secretion system p...   489   e-137
gi|12229774|sp|Q9ZLT4|CAGE_HELPJ  CAG pathogenicity island p...   248   6e-65
gi|2498200|sp|Q48252|CAGE_HELPY  CAG pathogenicity island pr...   247   1e-64
gi|2499046|sp|P55399|TRBE2_RHISN  Probable conjugal transfer...   168   1e-40
gi|1730021|sp|P54910|TRBE_AGRTU  Conjugal transfer protein t...   162   6e-39
>gi|81827588|sp|Q6FYW7|VIRB4_BARQU Type IV secretion system protein virB4
          Length = 784

 Score = 1560 bits (4039), Expect = 0.0
 Identities = 784/784 (100%), Positives = 784/784 (100%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT
Sbjct: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL
Sbjct: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH
Sbjct: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180

Query: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240
           EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF
Sbjct: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240

Query: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300
           GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI
Sbjct: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300

Query: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360
           DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE
Sbjct: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360

Query: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420
           AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY
Sbjct: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420

Query: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480
           FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK
Sbjct: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP
Sbjct: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540

Query: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600
           HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL
Sbjct: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600

Query: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660
           DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM
Sbjct: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
           LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE
Sbjct: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR
Sbjct: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780

Query: 781 RENQ 784
           RENQ
Sbjct: 781 RENQ 784
>gi|81858639|sp|Q9R2W4|VIRB4_BARHE Type IV secretion system protein virB4
          Length = 784

 Score = 1494 bits (3867), Expect = 0.0
 Identities = 745/784 (95%), Positives = 765/784 (97%)

Query: 1   MSIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNT 60
           MS+MKRESLPE+YIPYIRH+NQHVIALNSRCLMTVM VEGVNFDTADI+ LNSLHNQLNT
Sbjct: 1   MSMMKRESLPEDYIPYIRHINQHVIALNSRCLMTVMVVEGVNFDTADIDQLNSLHNQLNT 60

Query: 61  LLRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120
           LL+NIADERVALYSHIIRRRETIYPES+FFSSFAATLDEKYKKKMVSQELYRNDLFVSLL
Sbjct: 61  LLKNIADERVALYSHIIRRRETIYPESQFFSSFAATLDEKYKKKMVSQELYRNDLFVSLL 120

Query: 121 WNPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAH 180
           WNP S KTEQLASFFQRL KAKKTQSEPD EAIRKIEELSQDLI+GLESY ARLLSVYAH
Sbjct: 121 WNPASDKTEQLASFFQRLAKAKKTQSEPDQEAIRKIEELSQDLIEGLESYGARLLSVYAH 180

Query: 181 EGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMF 240
            GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKE IEIRHESNERF GMF
Sbjct: 181 GGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKETIEIRHESNERFAGMF 240

Query: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQI 300
           GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAA VIMGRKQNQMINAADRASSQI
Sbjct: 241 GWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAASVIMGRKQNQMINAADRASSQI 300

Query: 301 DALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLE 360
           +ALDEALDDLESNRFVLGEHHLSLAVFA+ PK L EYLSKARAHLTNGGAVIAREDLGLE
Sbjct: 301 EALDEALDDLESNRFVLGEHHLSLAVFANHPKALAEYLSKARAHLTNGGAVIAREDLGLE 360

Query: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYY 420
           AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWG AVALLKTQAGSPYY
Sbjct: 361 AAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGTAVALLKTQAGSPYY 420

Query: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480
           FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK
Sbjct: 421 FNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQLQKHNPTMVFFDKDQGAEIFVRAGGGKYK 480

Query: 481 PLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDIAKAINSLESLP 540
           PLKNGQPTGIAPLKGMEYTEKNK+FLR+WVLKLVT EGQTVTE+ERQDIAKAI++L +LP
Sbjct: 481 PLKNGQPTGIAPLKGMEYTEKNKVFLRNWVLKLVTAEGQTVTEEERQDIAKAIDALGNLP 540

Query: 541 HAQRSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600
           HAQRSL ALQLFFDNTSKEGIAIRLQRW+KGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL
Sbjct: 541 HAQRSLSALQLFFDNTSKEGIAIRLQRWLKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFL 600

Query: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660
           DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM
Sbjct: 601 DNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMM 660

Query: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720
           LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE
Sbjct: 661 LFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRE 720

Query: 721 SRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           SRRFLIKQGQ+SVVAELNLRGMNDEIA+LSGTTKNIELVNQII++YGADPD WLPIFHQR
Sbjct: 721 SRRFLIKQGQSSVVAELNLRGMNDEIAVLSGTTKNIELVNQIISEYGADPDIWLPIFHQR 780

Query: 781 RENQ 784
           RENQ
Sbjct: 781 RENQ 784
>gi|61250192|sp|P0A3W0|VIRB4_AGRTU Protein virB4 precursor
 gi|61250194|sp|P0A3W1|VIRB4_AGRT9 Protein virB4 precursor
          Length = 789

 Score =  571 bits (1472), Expect = e-162
 Identities = 297/776 (38%), Positives = 468/776 (60%), Gaps = 11/776 (1%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E Y+PYI H++ H++ L    +M++  ++GV F+  +I   N+     NTLLRNIAD+ V
Sbjct: 13  EIYLPYIGHLSDHIVLLEDGSIMSIARIDGVAFELEEIEMRNARCRAFNTLLRNIADDHV 72

Query: 71  ALYSHIIRRRETIYPESRFFSS-FAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
           ++Y+H++R  +      R F S FAA+L+E ++++++S +L RND F++L+  P +    
Sbjct: 73  SIYAHLVRHADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNDHFLTLIVYPQAA--- 129

Query: 130 QLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQS 189
            L    +R TK    +       IR +E+L   +   L++Y    L +   +G+LF+E  
Sbjct: 130 -LGKVKRRFTKLSGKRENDLAGQIRNMEDLWHVVAGSLKAYGLHRLGIREKQGVLFTEIG 188

Query: 190 EFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSKT 249
           E L  ++ GR   +P+  G++ ++IY+DRVI GK  +EIR   +     ++ ++EYP+KT
Sbjct: 189 EALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKDSYVGSIYSFREYPAKT 248

Query: 250 RPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALDD 309
           RPGM + LL+  F  +LTQSF F ++  A   +  K +QM+++ D+A +QI  L EA D 
Sbjct: 249 RPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDA 308

Query: 310 LESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLPG 369
           L SN FV+G HHLSL V+AD   +L +  ++AR  + + GAV+ +E +G+EAA+W+QLPG
Sbjct: 309 LASNEFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPG 368

Query: 370 NFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDLG 429
           NF +R R GAITSRNFA    F +FP G   G+ WG A+A  +T  G+P+ +  H  D+G
Sbjct: 369 NFKWRTRPGAITSRNFAGFVSFENFPEGASSGH-WGTAIARFRTNGGTPFDYIPHEHDVG 427

Query: 430 NTFVCGPSGSGKTVIVNFLLAQLQK----HNPTMVFFDKDQGAEIFVRAGGGKYKPLKNG 485
            T + GP G GKT ++ F+LA L++       T+VFFDKD+G E+ VRA GG Y  L+ G
Sbjct: 428 MTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGELLVRATGGTYLALRRG 487

Query: 486 QPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ-TVTEQERQDIAKAINSLESLPHAQR 544
            P+G+APL+G+E T  +  FLR W++ L+ ++G+  ++ +E + + + I+   S     R
Sbjct: 488 TPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMR 547

Query: 545 SLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEE 604
           S+  L+ F  +   EG   RLQRW +G+ LGW FD + D++ LD    G+DMT  L+ EE
Sbjct: 548 SIAGLREFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEE 607

Query: 605 IRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFAT 664
           +  P   YL +RI  +IDGRR ++  DEF   L +  F A     L T+RK NGM++ AT
Sbjct: 608 VCAPAAAYLLHRIGAMIDGRRFVMSCDEFRAYLLNPKFSAVVDKFLLTVRKNNGMLILAT 667

Query: 665 QSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRF 724
           Q P+  L S +  +++ QC T+IF+P+  A+   Y++  K TE+EF+ I+ +++  SR+F
Sbjct: 668 QQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMTVGSRKF 727

Query: 725 LIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           L+K+   SV+ E +LR M + +A+LSG    +    ++      +   WL  F  R
Sbjct: 728 LLKRESGSVICEFDLRDMREYVAVLSGRANTVRFAARLREAQEGNSSGWLSEFMAR 783
>gi|20141869|sp|P17794|VIRB4_AGRT5 Protein virB4 precursor
          Length = 789

 Score =  570 bits (1470), Expect = e-162
 Identities = 300/777 (38%), Positives = 473/777 (60%), Gaps = 13/777 (1%)

Query: 11  EEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERV 70
           E Y+PY+ HV+ H++ L    +MT+  V G+ F+  D    N+     NTLLRNIAD+ V
Sbjct: 13  EVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHV 72

Query: 71  ALYSHIIRRRETIYPESRFF-SSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTE 129
           ++Y+H++R  +     +R F S+F+A+L E ++++++S +L RND F++L+ +P +    
Sbjct: 73  SIYAHLVRHDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAA--- 129

Query: 130 QLASFFQRLTKAKKTQSEPDMEA-IRKIEELSQDLIQGLESYEARLLSVYAHEGILFSEQ 188
            L    +R TK  + Q E D+ A  R +E+L   +   LE+Y  R L +   + +LF+E 
Sbjct: 130 -LGKVRRRFTKRYR-QKENDLTAQTRNLEDLWHLVAGALEAYGLRRLGIREKQDVLFTEV 187

Query: 189 SEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEYPSK 248
            E L  ++ GR   +P+  G++ ++IY+DRVI GK  +EIR   +     ++ ++EYP+ 
Sbjct: 188 GEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKDSYVGSIYSFREYPAT 247

Query: 249 TRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDEALD 308
           TRPGM + LL+  F  +LTQSF F +++ A   +  K +QM+++ D+A +QI  L EA D
Sbjct: 248 TRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAED 307

Query: 309 DLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWAQLP 368
            L SN FVLG HH+SL ++A+    L +  ++AR  L + GAV+ +E +G+EAA+W+QLP
Sbjct: 308 ALASNEFVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLP 367

Query: 369 GNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHYGDL 428
           GN+ +R R GAITSRNFA L  F +FP G   G+ WG A+A  +T  G+P+ +  H  D+
Sbjct: 368 GNYKWRTRPGAITSRNFAGLVSFENFPEGSGSGH-WGNAIARFRTNGGTPFDYIPHEHDV 426

Query: 429 GNTFVCGPSGSGKTVIVNFLLAQLQK----HNPTMVFFDKDQGAEIFVRAGGGKYKPLKN 484
           G T + GP G GKT ++ F+LA L++        +V FDKD+G+E+ VRA GG Y  L+ 
Sbjct: 427 GMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSELLVRATGGTYLALRR 486

Query: 485 GQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQ-TVTEQERQDIAKAINSLESLPHAQ 543
           G P+G+APL+G+E T  +  FLR W++ L+ ++G+  ++ +E + + + I+   S     
Sbjct: 487 GAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHM 546

Query: 544 RSLGALQLFFDNTSKEGIAIRLQRWIKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNE 603
           RS+  L+ F  +   EG   RLQRW +GN LGW FD + D++ LD    G+DMT  L+ E
Sbjct: 547 RSIAGLREFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYE 606

Query: 604 EIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFA 663
           E+      YL +RI  ++DGRR ++  DEF   L +  F A     L T+RK NGM++ A
Sbjct: 607 EVCAAAAAYLLHRIGAMVDGRRFVMSCDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILA 666

Query: 664 TQSPKDALNSTIAHTIIEQCPTQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRR 723
           TQ P+  L S +  +++ QC T+IF+P+  A+   Y++  K TE+EF+ I+ +++  SR+
Sbjct: 667 TQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMAVGSRK 726

Query: 724 FLIKQGQNSVVAELNLRGMNDEIAILSGTTKNIELVNQIINDYGADPDTWLPIFHQR 780
           FL+K+   SVV E +LR M + +A+LSG    +   +Q+    G +P  WL  F  R
Sbjct: 727 FLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMAR 783
>gi|148841286|sp|Q9RPY1|VIRB4_BRUSU Type IV secretion system protein virB4
          Length = 831

 Score =  525 bits (1352), Expect = e-148
 Identities = 312/806 (38%), Positives = 465/806 (56%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEELLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQ--QLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  +  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            S T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ASHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>gi|81850952|sp|Q8YDZ4|VIRB4_BRUME Type IV secretion system protein virB4
          Length = 831

 Score =  524 bits (1350), Expect = e-148
 Identities = 312/806 (38%), Positives = 465/806 (56%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQK--LAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  S  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTASATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            + T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>gi|123545428|sp|Q2YIT8|VIRB4_BRUA2 Type IV secretion system protein virB4
 gi|148841285|sp|P0C525|VIRB4_BRUAB Type IV secretion system protein virB4
          Length = 831

 Score =  523 bits (1348), Expect = e-147
 Identities = 311/806 (38%), Positives = 465/806 (57%), Gaps = 41/806 (5%)

Query: 13  YIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTLLRNIADERVAL 72
           +IP+   V    +       +    + G+ F+T D   L    +QLNTL R IA   VAL
Sbjct: 20  FIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVAL 79

Query: 73  YSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLWNPTSGKTEQLA 132
           +SH +RRR   + +S F + F   LD+KY        +  N+L++++++ P   K  +L 
Sbjct: 80  WSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLF 139

Query: 133 SFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESYEA------RLLSVYAHE-GILF 185
           +     + A+  Q +    AIRK++E+   +   L  Y         +LS Y  + G L 
Sbjct: 140 NVAVHRSHAEILQEQ--QLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALC 197

Query: 186 SEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNERFVGMFGWKEY 245
           S+Q EF + L+ G  +++ +    +   + +  V  G E IEIR  +  R+     +K+Y
Sbjct: 198 SQQLEFYNFLLSGEWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDY 257

Query: 246 PSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAADRASSQIDALDE 305
            + T PG+ +GL+ + +E+++TQSF F +K   +  + R++ ++ N  D ++SQI  +D 
Sbjct: 258 ANHTEPGILNGLMYSDYEYVITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDI 317

Query: 306 ALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAREDLGLEAAWWA 365
           A+D L    FV+GE+H SL VFA+  +T+    S A   L + G +        +AA++A
Sbjct: 318 AIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYA 377

Query: 366 QLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQAGSPYYFNFHY 425
           QLP N+ YR R   +TS NFA LS FH+F  GK +GN WG A+ LLKT +G P Y NFHY
Sbjct: 378 QLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHY 437

Query: 426 --GD--------LGNTFVCGPSGSGKTVIVNFLLAQLQK--HNPTM----VFFDKDQGAE 469
             GD        LGNT + G SG+GKTV++NF LAQ QK  HN  M    VFFDKDQGA+
Sbjct: 438 SKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAK 497

Query: 470 IFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEGQTVTEQERQDI 529
             + A GGKY  ++NG+PTG  P + ME T  N +FL   V  LV+ +GQ VT  +   I
Sbjct: 498 GTILAIGGKYLAIRNGEPTGFNPFQ-MEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRI 556

Query: 530 AKAINSLESL-PHAQRSLGALQLFFDNTSKE----GIAIRLQRWIKGNDLG------WVF 578
           + AI ++  + P  +R    LQ   + + ++     +A RL +W   +  G      WV 
Sbjct: 557 SHAIRTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVL 616

Query: 579 D--NDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVIDEFWKA 636
           D   DQ D N  S + G+D TDFLDN ++R P+ MYL +R+   IDGRR I  +DE WK 
Sbjct: 617 DCPQDQIDFNTHSNY-GFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKW 675

Query: 637 LEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFFPNQKANY 696
           ++D++F  FA ++  TIRKQNG+ +FATQ P   LNS +A  +++Q  T+I+ PN KA+Y
Sbjct: 676 VDDEAFSEFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADY 735

Query: 697 KDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAILSGTTKNI 756
            +Y + FK+T  EF++I+S +S ESR FL+KQG +S++  L L G +DE+AILSG++ N 
Sbjct: 736 HEYTDGFKVTNEEFDIIRS-MSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNN 794

Query: 757 ELVNQIINDYGADPDTWLPIFHQRRE 782
           EL++Q+I + G DP  WLP+F +RR+
Sbjct: 795 ELLDQVIAEVGDDPSVWLPVFQERRK 820
>gi|81424215|sp|Q7VSX9|PTLC_BORPE Type IV secretion system protein ptlC (Pertussis toxin liberation
           protein C)
          Length = 824

 Score =  490 bits (1262), Expect = e-137
 Identities = 284/813 (34%), Positives = 460/813 (55%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGENHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMMELRAPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR+R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRSRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
>gi|81425951|sp|Q7W2U3|PTLC_BORPA Type IV secretion system protein ptlC homolog
          Length = 824

 Score =  490 bits (1261), Expect = e-137
 Identities = 284/813 (34%), Positives = 459/813 (55%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGENHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPVDAYLGSSRILAGAEMMELRSPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
>gi|81579548|sp|Q7WDU1|PTLC_BORBR Type IV secretion system protein ptlC homolog
          Length = 824

 Score =  489 bits (1260), Expect = e-137
 Identities = 284/813 (34%), Positives = 459/813 (55%), Gaps = 41/813 (5%)

Query: 2   SIMKRESLPEEYIPYIRHVNQHVIALNSRCLMTVMAVEGVNFDTADINHLNSLHNQLNTL 61
           +I + E     +IPY  H+    +  +   L+    V+G+ F++A+   ++  H QLN L
Sbjct: 12  AIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNGL 71

Query: 62  LRNIADERVALYSHIIRRRETIYPESRFFSSFAATLDEKYKKKMVSQELYRNDLFVSLLW 121
            R I+ E+VAL+ H IRR+     ++R+ + F   LD  Y  ++ +++   N+ +++L++
Sbjct: 72  WRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVY 131

Query: 122 NPTSGKTEQLASFFQRLTKAKKTQSEPDMEAIRKIEELSQDLIQGLESY---EARLLSVY 178
            P      + A   Q   + +       +  +R+++E+   +   L S+     + ++V 
Sbjct: 132 RPGHAALGKRAHHGQAEVRRQL------LAHVRRMDEIGSLIETTLRSHGEDHEQAITVL 185

Query: 179 AHE----GILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVIFGKEMIEIRHESNE 234
             E    G  +S     L  L+ G  + + +  G + + + S R++ G EM+E+R  +  
Sbjct: 186 GCETDSAGRRYSRTLTLLEFLLTGHWQPVRVPAGPLDAYLGSSRILAGAEMMELRSPTCR 245

Query: 235 RFVGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAARVIMGRKQNQMINAAD 294
           R+     +KEY + T PGM + LL   +E+++T SF    K  A   + R++ Q+ N  D
Sbjct: 246 RYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHSFSAVGKRQALAYLQRQRAQLANVQD 305

Query: 295 RASSQIDALDEALDDLESNRFVLGEHHLSLAVFADQPKTLVEYLSKARAHLTNGGAVIAR 354
            A SQID L  A D L +  FV+GE+H S+ +    P+ L   +S A   +   G +   
Sbjct: 306 AAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVSSAMTRIQERGFLATP 365

Query: 355 EDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSFPIGKLEGNVWGAAVALLKTQ 414
             L L+AA++AQLP N++YR R   +TSRNFA L  FH+F  GK +GN WG A++LL T 
Sbjct: 366 VTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALSLLSTP 425

Query: 415 AGSPYYFNFHYGD----------LGNTFVCGPSGSGKTVIVNFLLAQLQKHNP------T 458
           +G P+YFNFH+            LGNT + G SGSGKTV++NFLL QLQK         T
Sbjct: 426 SGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLT 485

Query: 459 MVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKIFLRSWVLKLVTTEG 518
            +FFDKD+GAEI +RA  G+Y  +++G+PTG  PL+ +  T++N +FL S +  L     
Sbjct: 486 TIFFDKDRGAEICIRALDGQYLRIRDGEPTGFNPLQ-LPCTDRNVMFLDSLLAMLARAHD 544

Query: 519 QTVTEQERQDIAKAINSLESLPHAQRSLGA-LQLFFDNTSKE-GIAIRLQRWIKGNDLG- 575
             +T  +   +A A+ ++  +P + R +   LQ     TS++  +  RL RW + +  G 
Sbjct: 545 SPLTSAQHATLATAVRTVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGG 604

Query: 576 -----WVFDNDQDDLNLDSQ-FIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIV 629
                WVFDN  D L+       G D T FLDN E R P+ MYL +R+ + +DGRR + +
Sbjct: 605 TGMLWWVFDNPNDCLDFSRPGNYGIDGTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYL 664

Query: 630 IDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCPTQIFF 689
           +DE WK ++D +F  FA D+  TIRK+NG+ +F+TQ P   L + +A ++++QC T+I+ 
Sbjct: 665 MDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQMPSSLLGARVAASLVQQCATEIYL 724

Query: 690 PNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQNSVVAELNLRGMNDEIAIL 749
           PN +A+  +Y++ FK TE E++LI+S ++ +S  FL+KQG+ +VVA+L+L GM+DE+AIL
Sbjct: 725 PNPRADRAEYLDGFKCTETEYQLIRS-MAEDSHLFLVKQGRQAVVAQLDLSGMDDELAIL 783

Query: 750 SGTTKNIELVNQIIN-DYGADPDTWLPIFHQRR 781
           SG  +N+    Q +      DP+ W+ +FH+ R
Sbjct: 784 SGNARNLRCFEQALALTRERDPNDWIAVFHRLR 816
  Database: SPROT
    Posted date:  Mar 11, 2008  6:16 PM
  Number of letters in database: 115,465,120
  Number of sequences in database:  309,621
  
Lambda     K      H
   0.320    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 170,871,214
Number of Sequences: 309621
Number of extensions: 7301604
Number of successful extensions: 24678
Number of sequences better than 1.0e-05: 14
Number of HSP's better than  0.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 24593
Number of HSP's gapped (non-prelim): 15
length of query: 784
length of database: 115,465,120
effective HSP length: 123
effective length of query: 661
effective length of database: 77,381,737
effective search space: 51149328157
effective search space used: 51149328157
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 124 (52.4 bits)